Cyclin homolog

Details

Name
Cyclin homolog
Synonyms
  • ECLF2
  • V-cyclin
Gene Name
72
Organism
SaHV-2
Amino acid sequence
>lcl|BSEQ0012678|Cyclin homolog
MADSPNRLNRAKIDSTTMKDPRVLNNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMH
LLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLT
YLSCDCFTNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPEDLWPQLYEAASTT
ICKALIQPNIALLSPGLICAGGLLTTIETDNTNCRPWTCYLEDLSSILNFSTNTVRTVKD
QVSEAFSLYDLEIL
Number of residues
254
Molecular Weight
28637.055
Theoretical pI
5.15
GO Classification
Processes
cell cycle / cell division / modulation by virus of host cell cycle
General Function
Not Available
Specific Function
May be highly relevant to the process of cellular transformation and rapid T-cell proliferation effected by HVS during latent infections of T-cells in susceptible hosts.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012679|Cyclin homolog (72)
ATGGCAGATTCACCAAACAGACTCAACAGAGCTAAAATAGACTCTACTACCATGAAAGAC
CCAAGAGTGCTAAACAACTTAAAACTCCGAGAACTGTTACTGCCAAAATTTACCAGTCTA
TGGGAAATACAAACAGAAGTAACTGTTGACAATAGAACTATACTGCTTACCTGGATGCAT
CTGCTCTGTGAAAGCTTTGAGTTAGACAAAAGTGTGTTTCCTCTCAGTGTATCAATCTTA
GACAGATATCTGTGTAAAAAGCAAGGCACTAAAAAGACATTACAAAAAATAGGAGCTGCA
TGTGTCTTGATAGGAAGCAAGATAAGAACTGTAAAGCCAATGACTGTGTCAAAACTGACT
TATTTATCTTGTGACTGTTTTACAAATTTAGAGCTCATCAACCAAGAAAAAGACATTTTA
GAAGCACTGAAATGGGACACTGAAGCTGTACTTGCTACAGACTTTTTAATTCCACTGTGT
AATGCTTTAAAAATACCAGAAGATCTTTGGCCTCAGCTGTATGAAGCAGCTAGTACTACT
ATTTGCAAAGCTTTAATTCAACCCAACATAGCTCTGTTGTCTCCAGGTCTTATTTGTGCA
GGAGGACTGTTAACAACTATTGAAACTGACAACACTAACTGCAGACCTTGGACTTGTTAC
TTAGAAGACCTTTCTTCTATTTTGAACTTCTCTACTAACACAGTAAGAACAGTAAAAGAT
CAGGTGTCTGAAGCATTTTCTTTATATGACCTCGAAATTCTGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ01043
UniProtKB Entry NameCGH2_SHV21
GenBank Protein ID243355
GenBank Gene IDS76368
General References
  1. Albrecht JC, Nicholas J, Biller D, Cameron KR, Biesinger B, Newman C, Wittmann S, Craxton MA, Coleman H, Fleckenstein B, et al.: Primary structure of the herpesvirus saimiri genome. J Virol. 1992 Aug;66(8):5047-58. [PubMed:1321287]
  2. Nicholas J, Cameron KR, Coleman H, Newman C, Honess RW: Analysis of nucleotide sequence of the rightmost 43 kbp of herpesvirus saimiri (HVS) L-DNA: general conservation of genetic organization between HVS and Epstein-Barr virus. Virology. 1992 May;188(1):296-310. [PubMed:1314457]
  3. Nicholas J, Cameron KR, Honess RW: Herpesvirus saimiri encodes homologues of G protein-coupled receptors and cyclins. Nature. 1992 Jan 23;355(6358):362-5. [PubMed:1309943]
  4. Schulze-Gahmen U, Jung JU, Kim SH: Crystal structure of a viral cyclin, a positive regulator of cyclin-dependent kinase 6. Structure. 1999 Mar 15;7(3):245-54. [PubMed:10368294]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB07379(2S)-2-({6-[(3-Amino-5-chlorophenyl)amino]-9-isopropyl-9H-purin-2-yl}amino)-3-methyl-1-butanolexperimentalunknownDetails
DB07795FisetinexperimentalunknownDetails