Penicillin-binding protein 1A

Details

Name
Penicillin-binding protein 1A
Synonyms
  • PBP-1A
Gene Name
ponA
Organism
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Amino acid sequence
>lcl|BSEQ0012376|Penicillin-binding protein 1A
MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSESKLVATTSSKIYDNKN
QLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDTIRILGAFLRNLQSNSLQ
GGSTLTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQKATKQEILTYYINKVYMSNGN
YGMQTAAQNYYGKDLNNLSLPQLALLAGMPQAPNQYDPYSHPEAAQDRRNLVLSEMKNQG
YISAEQYEKAVNTPITDGLQSLKSASNYPAYMDNYLKEVINQVEEETGYNLLTTGMDVYT
NVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGKVIAQLGARHQSSNVSFGINQ
AVETNRDWGSTMKPITDYAPALEYGVYDSTATIVHDEPYNYPGTNTPVYNWDRGYFGNIT
LQYALQQSRNVPAVETLNKVGLNRAKTFLNGLGIDYPSIHYSNAISSNTTESDKKYGASS
EKMAAAYAAFANGGTYYKPMYIHKVVFSDGSEKEFSNVGTRAMKETTAYMMTDMMKTVLT
YGTGRNAYLAWLPQAGKTGTSNYTDEEIENHIKTSQFVAPDELFAGYTRKYSMAVWTGYS
NRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWNIPEGLYRNGEFVFKNGARSTWNSPA
PQQPPSTESSSSSSDSSTSQSSSTTPSTNNSTTTNPNNNTQQSNTTPDQQNQNPQPAQP
Number of residues
719
Molecular Weight
79757.96
Theoretical pI
5.29
GO Classification
Functions
catalytic activity / penicillin binding
Processes
cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape / response to antibiotic
Components
extracellular region
General Function
Penicillin binding
Specific Function
Cell wall formation.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0012377|Penicillin-binding protein 1A (ponA)
ATGAACAAACCAACGATTCTGCGCCTAATCAAGTATCTGAGCATTAGCTTCTTAAGCTTG
GTTATCGCAGCCATTGTCTTAGGCGGAGGAGTTTTTTTCTACTACGTTAGCAAGGCTCCT
AGCCTATCCGAGAGTAAACTAGTTGCAACAACTTCTAGTAAAATCTACGACAATAAAAAT
CAACTCATTGCTGACTTGGGTTCTGAACGCCGCGTCAATGCCCAAGCTAATGATATTCCC
ACAGATTTGGTTAAGGCAATCGTTTCTATCGAAGACCATCGCTTCTTCGACCACAGGGGG
ATTGATACCATCCGTATCCTGGGAGCTTTCTTGCGCAATCTGCAAAGCAATTCCCTCCAA
GGTGGATCAACTCTCACCCAACAGTTGATTAAGTTGACTTACTTTTCAACTTCGACTTCC
GACCAGACTATTTCTCGTAAGGCTCAGGAAGCTTGGTTAGCGATTCAGTTAGAACAAAAA
GCAACCAAGCAAGAAATCTTGACCTACTATATAAATAAGGTCTACATGTCTAATGGGAAC
TATGGAATGCAGACAGCAGCTCAAAACTACTATGGTAAAGACCTCAATAATTTAAGTTTA
CCTCAGTTAGCCTTGCTGGCTGGAATGCCTCAGGCACCAAACCAATATGACCCCTATTCA
CATCCAGAAGCAGCCCAAGACCGCCGAAACTTGGTCTTATCTGAAATGAAAAATCAAGGC
TACATCTCTGCTGAACAGTATGAGAAAGCAGTCAATACACCAATTACTGATGGACTACAA
AGTCTCAAATCAGCAAGTAATTACCCTGCTTACATGGATAATTACCTCAAGGAAGTCATC
AATCAAGTTGAAGAAGAAACAGGCTATAACCTACTCACAACTGGGATGGATGTCTACACA
AATGTAGACCAAGAAGCTCAAAAACATCTGTGGGATATTTACAATACAGACGAATACGTT
GCCTATCCAGACGATGAATTGCAAGTCGCTTCTACCATTGTTGATGTTTCTAACGGTAAA
GTCATTGCCCAGCTAGGAGCACGCCATCAGTCAAGTAATGTTTCCTTCGGAATTAACCAA
GCAGTAGAAACAAACCGCGACTGGGGATCAACTATGAAACCGATCACAGACTATGCTCCT
GCCTTGGAGTACGGTGTCTACGATTCAACTGCTACTATCGTTCACGATGAGCCCTATAAC
TACCCTGGGACAAATACTCCTGTTTATAACTGGGATAGGGGCTACTTTGGCAACATCACC
TTGCAATACGCCCTGCAACAATCGCGAAACGTCCCAGCCGTGGAAACTCTAAACAAGGTC
GGACTCAACCGCGCCAAGACTTTCCTAAATGGTCTAGGAATCGACTACCCAAGTATTCAC
TACTCAAATGCCATTTCAAGTAACACAACCGAATCAGACAAAAAATATGGAGCAAGTAGT
GAAAAGATGGCTGCTGCTTACGCTGCCTTTGCAAATGGTGGAACTTACTATAAACCAATG
TATATCCATAAAGTCGTCTTTAGTGATGGGAGTGAAAAAGAGTTCTCTAATGTCGGAACT
CGTGCCATGAAGGAAACGACAGCCTATATGATGACCGACATGATGAAAACAGTCTTGACT
TATGGAACTGGACGAAATGCCTATCTTGCTTGGCTCCCTCAGGCTGGTAAAACAGGAACC
TCTAACTATACAGACGAGGAAATTGAAAACCACATCAAGACCTCTCAATTTGTAGCACCT
GATGAACTATTTGCTGGCTATACGCGTAAATATTCAATGGCTGTATGGACAGGCTATTCT
AACCGTCTGACACCACTTGTAGGCAATGGCCTTACGGTCGCTGCCAAAGTTTACCGCTCT
ATGATGACCTACCTGTCTGAAGGAAGCAATCCAGAAGATTGGAATATACCAGAGGGGCTC
TACAGAAATGGAGAATTCGTATTTAAAAATGGTGCTCGTTCTACGTGGAACTCACCTGCT
CCACAACAACCCCCATCAACTGAAAGTTCAAGCTCATCATCAGATAGTTCAACTTCACAG
TCTAGCTCAACCACTCCAAGCACAAATAATAGTACGACTACCAATCCTAACAATAATACG
CAACAATCAAATACAACCCCTGATCAACAAAATCAGAATCCTCAACCAGCACAACCATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ04707
UniProtKB Entry NamePBPA_STRPN
GenBank Gene IDX67873
General References
  1. Martin C, Sibold C, Hakenbeck R: Relatedness of penicillin-binding protein 1a genes from different clones of penicillin-resistant Streptococcus pneumoniae isolated in South Africa and Spain. EMBO J. 1992 Nov;11(11):3831-6. [PubMed:1396576]
  2. Tettelin H, Nelson KE, Paulsen IT, Eisen JA, Read TD, Peterson S, Heidelberg J, DeBoy RT, Haft DH, Dodson RJ, Durkin AS, Gwinn M, Kolonay JF, Nelson WC, Peterson JD, Umayam LA, White O, Salzberg SL, Lewis MR, Radune D, Holtzapple E, Khouri H, Wolf AM, Utterback TR, Hansen CL, McDonald LA, Feldblyum TV, Angiuoli S, Dickinson T, Hickey EK, Holt IE, Loftus BJ, Yang F, Smith HO, Venter JC, Dougherty BA, Morrison DA, Hollingshead SK, Fraser CM: Complete genome sequence of a virulent isolate of Streptococcus pneumoniae. Science. 2001 Jul 20;293(5529):498-506. [PubMed:11463916]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05659Faropenem medoxomilinvestigationalunknownDetails
DB01150CefprozilapprovedyesinhibitorDetails