Protein P

Details

Name
Protein P
Synonyms
  • 2.7.7.7
Gene Name
P
Organism
HBV-F
Amino acid sequence
>lcl|BSEQ0010386|Protein P
MPLSYPHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAADLNLQLPNVSIPWTHKVGNFT
GLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGPLTKNELRRLKLVMPARFYPKVT
KYFPMDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRESTRSASFCGSPYSWEQELQ
HGSTSLNDTKRHGTESLCAQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS
GRLRSRVHTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTSTGN
AVELNPVPPSSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLEDWGPCYEHGQHYI
RTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTTRVSWPKFAVPNLQSLTNLLS
SNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIHDHQHGTLQNLHN
SCTRNLYVSLLLLFQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRA
FPHCLAFSYMDDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTSKTKRWGYSLHFMGYVI
GSWGSLPQDHIVHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYAC
ITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYV
PSALNPADDPSRGRLGLYRPLLRLPFQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAW
RPP
Number of residues
843
Molecular Weight
94257.43
Theoretical pI
10.12
GO Classification
Functions
DNA binding / DNA-directed DNA polymerase activity / metal ion binding / RNA-directed DNA polymerase activity / RNA-DNA hybrid ribonuclease activity
Processes
suppression by virus of host innate immune response
General Function
Rna-dna hybrid ribonuclease activity
Specific Function
Multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3'- to 5'-endonucleasic mode. Neo-synthesized pregenomic RNA (pgRNA) are encapsidated together with the P protein, and reverse-transcribed inside the nucleocapsid. Initiation of reverse-transcription occurs first by binding the epsilon loop on the pgRNA genome, and is initiated by protein priming, thereby the 5'-end of (-)DNA is covalently linked to P protein. Partial (+)DNA is synthesized from the (-)DNA template and generates the relaxed circular DNA (RC-DNA) genome. After budding and infection, the RC-DNA migrates in the nucleus, and is converted into a plasmid-like covalently closed circular DNA (cccDNA). The activity of P protein does not seem to be necessary for cccDNA generation, and is presumably released from (+)DNA by host nuclear DNA repair machinery (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0001107|2532 bp
ATGCCCCTATCCTATCCACACTTCCGGAAACTACTGTTGTTAGACGACGAGGCAGGTCCC
CTAGAAGAAGAACTCCCTCGCCTCGCAGACGAAGATCTCAATCGCCGCGTCGCCGCAGAT
CTCAATCTCCAGCTTCCCAATGTTAGTATTCCTTGGACTCATAAGGTGGGAAACTTTACG
GGGCTTTACTCTTCTACTGTGCCTGCTTTTAATCCTAACTGGTCCACTCCTTCTTTTCCT
GATATTCATTTGCATCAAGACCTGATTTCTAAATGTGAACAATTTGTAGGCCCACTTACT
AAAAATGAATTACGAAGATTAAAATTGGTTATGCCAGCTAGATTTTATCCTAAGGTTACC
AAATATTTTCCCATGGATAAAGGCATCAAACCCTATTATCCTGAGCATGCAGTTAATCAT
TACTTTAAAACCAGACATTATTTGCATACTTTATGGAAGGCGGGAATTTTATATAAGAGA
GAATCCACACGTAGCGCCTCATTTTGTGGGTCACCATATTCCTGGGAACAAGAGCTACAG
CATGGGAGCACCTCTCTCAACGACACGAAGAGGCATGGGACAGAATCTCTCTGTGCCCAA
TCCTCTGGGATTCTTTCCAGACCATCAGCTGGATCCGCTATTCAGAGCAAATTCCAGCAG
TCCCGACTGGGACTTCAACACAAACAAGGACAGTTGGCCAATGGCAAACAAGGTAGGAGT
GGGAGGCTACGGTCCAGGGTTCACACCCCCACACGGTGGCCTGCTGGGGTGGAGCCCTCA
AGCACAAGGTGTGTTAACAACCTTGCCAGCAGATCCGCCTCCTGCTTCCACCAATCGGCG
GTCCGGGAGAAAGCCAACCCCAGTCTCTCCACCTCTAAGAGACACACATCCACAGGCAAT
GCAGTGGAACTCAACCCAGTTCCACCAAGCTCTGTTGGATCCCAGGGTAAGGGCTCTGTA
CTTCCCTGCTGGTGGCTCCAGTTCAGGGACACAGAACCCTGCTCCGACTATTGCCTCTCT
CACATCATCAATCTTCTCGAAGACTGGGGGCCCTGCTATGAACATGGACAACATTACATC
AGGACTCCTAGGACCCCTGCTCGTGTTACAGGCGGTGTGTTTCTTGTTGACAAAAATCCT
CACAATACCACAGAGTCTAGACTCGTGGTGGACTTCTCTCAATTTTCTAGGGGGACTACC
CGGGTGTCCTGGCCAAAATTCGCAGTCCCCAACCTCCAATCACTTACCAACCTCCTGTCC
TCCAACTTGTCCTGGCTATCGTTGGATGTGTCTGCGGCGTTTTATCATCTTCCTCTTCAT
CCTGCTGCTATGCCTCATCTTCTTGTTGGTTCTTCTGGACTATCAAGGTATGTTGCCCGT
TTGTCCTCTACTTCCAGGATCCACGACCACCAGCACGGGACCCTGCAAAACCTGCACAAC
TCTTGCACAAGGAACCTCTATGTTTCCCTCCTGTTGCTGTTCCAAACCCTCGGACGGAAA
CTGCACTTGTATTCCCATCCCATCATCCTGGGCTTTAGGAAAATACCTATGGGAGTGGGC
CTCAGCCCGTTTCTCCTGGCTCAGTTTACTAGTGCAATTTGTTCAGTGGTGCGTCGGGCT
TTCCCCCACTGTTTGGCTTTTAGTTATATGGATGATCTGGTATTGGGGGCCAAATCTGTG
CAGCATCTTGAGTCCCTTTATACCGCTGTTACCAATTTTCTGTTATCTGTGGGTATCCAT
TTAAATACCTCTAAAACAAAAAGATGGGGTTACTCCCTACATTTTATGGGTTATGTCATT
GGTAGTTGGGGATCATTACCCCAAGATCACATTGTACACAAAATCAAGGAATGCTTTCGA
AAACTGCCTGTAAATCGTCCAATTGATTGGAAAGTTTGTCAACGCATAGTGGGTCTTTTG
GGCTTTGCTGCCCCTTTCACCCAATGCGGTTATCCTGCTCTCATGCCTCTGTATGCCTGT
ATTACTGCTAAACAGGCTTTTGTCTTCTCGCCAACCTACAAGGCCTTTCTGTGTAAACAA
TACATGAACCTTTACCCGGTTGCTCGGCAACGGCCAGGCCTGTGCCAAGTGTTTGCTGAC
GCAACCCCCACTGGTTGGGGCTTGGCCATTGGCCATCAGCGCATGCGTGGAACCTTTGTG
GCTCCTCTGCCGATCCATACTGCGGAACTCCTAGCAGCTTGTTTCGCTCGCAGCAGGTCT
GGAGCGACTCTCATCGGCACGGACAATTCTGTTGTCCTCTCTAGGAAGTACACCTCCTTT
CCATGGCTGCTCGGATGTGCTGCAAACTGGATCCTGCGCGGGACGTCCTTTGTTTACGTC
CCATCGGCGCTGAATCCCGCGGACGACCCCTCCCGGGGCCGCTTGGGGCTGTACCGCCCT
CTTCTCCGTCTGCCGTTCCAGCCGACGACGGGTCGCACCTCTCTTTACGCGGACTCCCCG
TCTGTTCCTTCTCATCTGCCGGACCGTGTGCACTTCGCTTCACCTCTGCACGTCGCATGG
AGACCACCGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ05486
UniProtKB Entry NameDPOL_HBVF1
GenBank Protein ID59427
GenBank Gene IDX69798
General References
  1. Naumann H, Schaefer S, Yoshida CF, Gaspar AM, Repp R, Gerlich WH: Identification of a new hepatitis B virus (HBV) genotype from Brazil that expresses HBV surface antigen subtype adw4. J Gen Virol. 1993 Aug;74 ( Pt 8):1627-32. [PubMed:8345355]
  2. Beck J, Nassal M: Hepatitis B virus replication. World J Gastroenterol. 2007 Jan 7;13(1):48-64. [PubMed:17206754]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00709Lamivudineapproved, investigationalyesinhibitorDetails
DB01265Telbivudineapproved, investigationalyesDetails