Ferredoxin--NADP reductase

Details

Name
Ferredoxin--NADP reductase
Synonyms
  • 1.18.1.2
  • FNR
Gene Name
fpr
Organism
Azotobacter vinelandii
Amino acid sequence
>lcl|BSEQ0012083|Ferredoxin--NADP reductase
MSNLNVERVLSVHHWNDTLFSFKTTRNPSLRFENGQFVMIGLEVDGRPLMRAYSIASPNY
EEHLEFFSIKVQNGPLTSRLQHLKEGDELMVSRKPTGTLVTSDLLPGKHLYMLSTGTGLA
PFMSLIQDPEVYERFEKVVLIHGVRQVNELAYQQFITEHLPQSEYFGEAVKEKLIYYPTV
TRESFHNQGRLTDLMRSGKLFEDIGLPPINPQDDRAMICGSPSMLDESCEVLDGFGLKIS
PRMGEPGDYLIERAFVEK
Number of residues
258
Molecular Weight
29416.405
Theoretical pI
5.38
GO Classification
Functions
ferredoxin-NADP+ reductase activity
General Function
Ferredoxin-nadp+ reductase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005792|777 bp
ATGAGCAATCTGAACGTAGAGCGTGTCCTCAGTGTTCATCACTGGAACGATACCCTGTTC
AGTTTCAAGACCACCCGCAACCCCAGCCTGCGTTTCGAAAACGGCCAATTCGTGATGATC
GGTCTGGAGGTCGATGGACGTCCCCTGATGCGGGCCTACAGCATTGCCAGCCCGAATTAC
GAGGAACATCTGGAGTTCTTCAGCATCAAGGTACAGAACGGTCCGCTCACTTCGCGCCTG
CAACACCTGAAGGAGGGCGACGAACTGATGGTCAGCCGCAAGCCCACCGGCACCCTGGTG
ACCAGCGACCTGCTGCCCGGCAAGCATCTTTACATGCTCAGCACCGGTACCGGACTCGCG
CCTTTCATGAGCCTGATCCAGGACCCGGAGGTCTACGAGCGCTTCGAGAAGGTGGTGCTG
ATCCATGGTGTGCGTCAGGTCAACGAACTGGCCTATCAGCAGTTCATCACCGAGCACCTG
CCGCAGAGCGAGTATTTCGGTGAGGCGGTCAAGGAAAAGCTGATCTACTACCCGACGGTC
ACCCGCGAGTCCTTCCACAACCAGGGACGTCTCACCGACCTGATGCGCAGCGGCAAGCTG
TTCGAGGATATCGGTCTGCCGCCGATCAACCCGCAGGACGATCGCGCGATGATCTGCGGC
AGCCCGAGCATGCTCGACGAGAGTTGCGAAGTGCTGGACGGATTCGGCCTGAAGATCTCT
CCGCGCATGGGCGAGCCGGGCGACTATCTGATCGAGCGCGCCTTCGTCGAAAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ44532
UniProtKB Entry NameFENR_AZOVI
GenBank Gene IDL36319
General References
  1. Isas JM, Yannone SM, Burgess BK: Azotobacter vinelandii NADPH:ferredoxin reductase cloning, sequencing, and overexpression. J Biol Chem. 1995 Sep 8;270(36):21258-63. [PubMed:7673160]
  2. Isas JM, Burgess BK: Purification and characterization of a NADP+/NADPH-specific flavoprotein that is overexpressed in FdI- strains of Azotobacter vinelandii. J Biol Chem. 1994 Jul 29;269(30):19404-9. [PubMed:8034707]
  3. Sridhar Prasad G, Kresge N, Muhlberg AB, Shaw A, Jung YS, Burgess BK, Stout CD: The crystal structure of NADPH:ferredoxin reductase from Azotobacter vinelandii. Protein Sci. 1998 Dec;7(12):2541-9. [PubMed:9865948]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails