Cytochrome c-550

Details

Name
Cytochrome c-550
Synonyms
  • Cytochrome c549
  • Cytochrome c550
  • Low-potential cytochrome c
  • petK
Gene Name
psbV
Organism
Synechocystis sp. (strain PCC 6803 / Kazusa)
Amino acid sequence
>lcl|BSEQ0005962|Cytochrome c-550
MKRFFLVAIASVLFFFNTMVGSANAVELTESTRTIPLDEAGGTTTLTARQFTNGQKIFVD
TCTQCHLQGKTKTNNNVSLGLADLAGAEPRRDNVLALVEFLKNPKSYDGEDDYSELHPNI
SRPDIYPEMRNYTEDDIFDVAGYTLIAPKLDERWGGTIYF
Number of residues
160
Molecular Weight
17883.935
Theoretical pI
4.54
GO Classification
Functions
electron carrier activity / heme binding / iron ion binding
Processes
cytochrome c-heme linkage / photosynthesis, light reaction / respiratory electron transport chain
Components
plasma membrane-derived thylakoid photosystem II / thylakoid membrane
General Function
Iron ion binding
Specific Function
Low-potential cytochrome c that plays a role in the oxygen-evolving complex of photosystem II (PSII). Required for normal function or stabilization of PSII. Extrinsic protein associated with PSII that enhances oxygen evolution.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cellular thylakoid membrane
Gene sequence
>lcl|BSEQ0005961|483 bp
GTGAAACGCTTTTTTCTGGTGGCGATCGCCTCTGTCCTATTTTTCTTTAACACCATGGTC
GGCAGTGCCAATGCGGTGGAGTTAACCGAAAGCACCCGCACCATTCCCCTCGATGAAGCC
GGTGGCACCACAACCTTAACCGCCCGCCAGTTCACCAACGGCCAAAAGATTTTTGTGGAC
ACCTGCACCCAATGTCACCTCCAGGGTAAAACCAAAACTAATAATAACGTTAGTTTAGGC
TTGGCAGACTTGGCTGGTGCCGAGCCCCGTCGGGACAACGTCCTGGCCTTGGTGGAATTT
CTCAAGAATCCCAAGAGTTATGACGGTGAAGATGACTATTCGGAATTACATCCCAATATT
TCCCGTCCCGACATCTACCCAGAAATGAGAAACTACACCGAAGACGACATCTTTGATGTG
GCTGGTTACACCCTCATTGCTCCCAAATTAGATGAACGGTGGGGTGGCACCATCTACTTC
TAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ55013
UniProtKB Entry NameCY550_SYNY3
GenBank Gene IDD45178
General References
  1. Shen JR, Vermaas W, Inoue Y: The role of cytochrome c-550 as studied through reverse genetics and mutant characterization in Synechocystis sp. PCC 6803. J Biol Chem. 1995 Mar 24;270(12):6901-7. [PubMed:7896839]
  2. Kaneko T, Sato S, Kotani H, Tanaka A, Asamizu E, Nakamura Y, Miyajima N, Hirosawa M, Sugiura M, Sasamoto S, Kimura T, Hosouchi T, Matsuno A, Muraki A, Nakazaki N, Naruo K, Okumura S, Shimpo S, Takeuchi C, Wada T, Watanabe A, Yamada M, Yasuda M, Tabata S: Sequence analysis of the genome of the unicellular cyanobacterium Synechocystis sp. strain PCC6803. II. Sequence determination of the entire genome and assignment of potential protein-coding regions. DNA Res. 1996 Jun 30;3(3):109-36. [PubMed:8905231]
  3. Kang C, Chitnis PR, Smith S, Krogmann DW: Cloning and sequence analysis of the gene encoding the low potential cytochrome c of Synechocystis PCC 6803. FEBS Lett. 1994 May 9;344(1):5-9. [PubMed:8181563]
  4. Sazuka T, Ohara O: Towards a proteome project of cyanobacterium Synechocystis sp. strain PCC6803: linking 130 protein spots with their respective genes. Electrophoresis. 1997 Aug;18(8):1252-8. [PubMed:9298645]
  5. Kashino Y, Lauber WM, Carroll JA, Wang Q, Whitmarsh J, Satoh K, Pakrasi HB: Proteomic analysis of a highly active photosystem II preparation from the cyanobacterium Synechocystis sp. PCC 6803 reveals the presence of novel polypeptides. Biochemistry. 2002 Jun 25;41(25):8004-12. [PubMed:12069591]
  6. Frazao C, Enguita FJ, Coelho R, Sheldrick GM, Navarro JA, Hervas M, De la Rosa MA, Carrondo MA: Crystal structure of low-potential cytochrome c549 from Synechocystis sp. PCC 6803 at 1.21 A resolution. J Biol Inorg Chem. 2001 Mar;6(3):324-32. [PubMed:11315568]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails