PBP3

Details

Name
PBP3
Synonyms
  • ftsI
  • Penicillin-binding protein 3
Gene Name
pbp3
Organism
Haemophilus influenzae
Amino acid sequence
>lcl|BSEQ0022081|PBP3
MVKFNSSRKSGKSKKTIRKLTAPETVKQNKPQKVFEKCFMRGRYMLSTVLILLGLCALVA
RAAYVQSINADTLSNEADKRSLRKDEVLSVRGSILDRNGQLLSVSVPMSAIVADPKTMLK
ENSLADKERIAALAEELGMTENDLVKKIEKNSKSGYLYLARQVELSKANYIRRLKIKGII
LETEHRRFYPRVEEAAHVVGYTDIDGNGIEGIEKSFNSLLVGKDGSRTVRKDKRGNIVEH
ISDEKKYDAQDVTLSIDEKLQSMVYREIKKAVSENNAESGTAVLVDVRTGEVLAMATAPS
YNPNNRVGVKSELMRNRAITDTFEPGSTVKPFVVLTALQRGVVKRDEIINTTSFKLNGKE
IVDVAPRAQQTLDEILINSSNRGVTRLAFRMPPSALMETYQNAGLSKPTDLGLIGEQVGI
LNANRKRWADIERATVAYGYGITATPLQIARAYATLGSFGVYRPLSITKVDPPVIGKRVF
SEKITKDIVGILEKVAIKNKRAMVEGYRVGVKTGTARKIENGHYVKKYVAFTAGIAPISD
PRYALVILINDPKAGEYYGGALSAPVFSSIMGYALRANAIPQDAEAAENTTTKSAKRIVY
IGEHKNQKVN
Number of residues
610
Molecular Weight
67295.025
Theoretical pI
10.26
GO Classification
Functions
penicillin binding
General Function
Penicillin binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ60FT7
UniProtKB Entry NameQ60FT7_HAEIF
General References
  1. Osaki Y, Sanbongi Y, Ishikawa M, Kataoka H, Suzuki T, Maeda K, Ida T: Genetic approach to study the relationship between penicillin-binding protein 3 mutations and Haemophilus influenzae beta-lactam resistance by using site-directed mutagenesis and gene recombinants. Antimicrob Agents Chemother. 2005 Jul;49(7):2834-9. [PubMed:15980357]
  2. Takahata S, Ida T, Senju N, Sanbongi Y, Miyata A, Maebashi K, Hoshiko S: Horizontal gene transfer of ftsI, encoding penicillin-binding protein 3, in Haemophilus influenzae. Antimicrob Agents Chemother. 2007 May;51(5):1589-95. Epub 2007 Feb 26. [PubMed:17325223]
  3. Park C, Kim KH, Shin NY, Byun JH, Kwon EY, Lee JW, Kwon HJ, Choi EY, Lee DG, Sohn WY, Kang JH: Genetic diversity of the ftsI gene in beta-lactamase-nonproducing ampicillin-resistant and beta-lactamase-producing amoxicillin-/clavulanic acid-resistant nasopharyngeal Haemophilus influenzae strains isolated from children in South Korea. Microb Drug Resist. 2013 Jun;19(3):224-30. doi: 10.1089/mdr.2012.0116. Epub 2013 Jan 11. [PubMed:23308379]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00535CefdinirapprovedyesinhibitorDetails