HBsAg
Details
- Name
- HBsAg
- Synonyms
- Major Surface Antigen
- S
- S protein
- sAg
- Small S protein
- Small surface antigen
- Surface antigen
- Gene Name
- S gene
- Organism
- HBV
- Amino acid sequence
>lcl|BSEQ0011738|HBsAg MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNH SPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGP CRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFV QWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
- Number of residues
- 226
- Molecular Weight
- 25420.905
- Theoretical pI
- 7.9
- GO Classification
- Processesmembrane fusion involved in viral entry into host cell / virion attachment to host cellComponentsintegral component of membrane / virion membrane
- General Function
- Not Available
- Specific Function
- Not Available
- Pfam Domain Function
- vMSA (PF00695)
- Transmembrane Regions
- 80-98 170-199 205-225
- Cellular Location
- Virion membrane
- Gene sequence
>lcl|BSEQ0004765|681 bp ATGGAGAACATCACATCAGGATTCCTAGGACCCCTTCTCGTGTTACAGGCGGGGTTTTTC TTGTTGACAAGAATCCTCACAATACCGCAGAGTCTAGACTCGTGGTGGACTTCTCTCAAT TTTCTAGGGGGAACTACCGTGTGTCTTGGCCAAAATTCGCAGTCCCCAACCTCCAATCAC TCACCAACCTCCTGTCCTCCAACTTGTCCTGGTTATCGCTGGATGTGTCTGCGGCGTTTT ATCATCTTCCTCTTCATCCTGCTGCTATGCCTCATCTTCTTGTTGGTTCTTCTGGACTAT CAAGGTATGTTGCCCGTTTGTCCTCTAATTCCAGGATCCTCAACCACCAGCACGGGACCA TGCCGAACCTGCATGACAACTGCTCAAGGAACCTCTATGTATCCCTCCTGTTGCTGTACC AAACCTTCGGACGGAAATTGCACCTGTATTCCCATCCCATCATCCTGGGCTTTCGGAAAA TTCCTATGGGAGTGGGCCTCAGCCCGTTTCTCCTGGCTCAGTTTACTAGTGCCATTTGTT CAGTGGTTCGTAGGGCTTTCCCCCACTGTTTGGCTTTCAGTTATATGGATGATGTGGTAT TGGGGGCCAAGTCTGTACAGCATCTTGAGTCCCTTTTTACCGCTGTTACCAATTTTCTTT TGTCTTTGGGTATACATTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q69600 UniProtKB Entry Name Q69600_HBV GenBank Gene ID X75668 - General References
- Norder H, Hammas B, Lofdahl S, Courouce AM, Magnius LO: Comparison of the amino acid sequences of nine different serotypes of hepatitis B surface antigen and genomic classification of the corresponding hepatitis B virus strains. J Gen Virol. 1992 May;73 ( Pt 5):1201-8. [Article]
- Arauz-Ruiz P, Norder H, Visona KA, Magnius LO: Molecular epidemiology of hepatitis B virus in Central America reflected in the genetic variability of the small S gene. J Infect Dis. 1997 Oct;176(4):851-8. [Article]
- Christensen PB, Krarup HB, Niesters HG, Norder H, Schaffalitzky de Muckadell OB, Jeune B, Georgsen J: Outbreak of Hepatitis B among injecting drug users in Denmark. J Clin Virol. 2001 Aug;22(1):133-41. [Article]
- Norder H, Courouce AM, Coursaget P, Echevarria JM, Lee SD, Mushahwar IK, Robertson BH, Locarnini S, Magnius LO: Genetic diversity of hepatitis B virus strains derived worldwide: genotypes, subgenotypes, and HBsAg subtypes. Intervirology. 2004;47(6):289-309. [Article]
- Zehender G, De Maddalena C, Giambelli C, Milazzo L, Schiavini M, Bruno R, Tanzi E, Galli M: Different evolutionary rates and epidemic growth of hepatitis B virus genotypes A and D. Virology. 2008 Oct 10;380(1):84-90. doi: 10.1016/j.virol.2008.07.009. Epub 2008 Aug 19. [Article]
- Ghosh S, Banerjee P, RoyChoudhury A, Sarkar S, Ghosh A, Santra A, Banerjee S, Das K, Dwibedi B, Kar SK, Rao VG, Bhat JT, Singh N, Chowdhury A, Datta S: Unique hepatitis B virus subgenotype in a primitive tribal community in eastern India. J Clin Microbiol. 2010 Nov;48(11):4063-71. doi: 10.1128/JCM.01174-10. Epub 2010 Sep 15. [Article]
- Pourkarim MR, Amini-Bavil-Olyaee S, Verbeeck J, Lemey P, Zeller M, Rahman M, Maes P, Nevens F, Van Ranst M: Molecular evolutionary analysis and mutational pattern of full-length genomes of hepatitis B virus isolated from Belgian patients with different clinical manifestations. J Med Virol. 2010 Mar;82(3):379-89. doi: 10.1002/jmv.21726. [Article]
- Habbal W, Monem F: Rethinking therapeutic decisions for hepatitis B infection in Syria: insights into molecular monitoring. J Infect Dev Ctries. 2012 Oct 19;6(10):744-7. doi: 10.3855/jidc.2596. [Article]
- Delwart E, Slikas E, Stramer SL, Kamel H, Kessler D, Krysztof D, Tobler LH, Carrick DM, Steele W, Todd D, Wright DJ, Kleinman SH, Busch MP: Genetic diversity of recently acquired and prevalent HIV, hepatitis B virus, and hepatitis C virus infections in US blood donors. J Infect Dis. 2012 Mar 15;205(6):875-85. doi: 10.1093/infdis/jir862. Epub 2012 Jan 31. [Article]
- Habbal W, Gartner BC, Monem F: Identification of optimal target gene regions for hepatitis B virus genotyping by DNA sequencing. Intervirology. 2013;56(5):325-36. doi: 10.1159/000353108. Epub 2013 Aug 20. [Article]
- Loureiro CL, Aguilar JC, Aguiar J, Muzio V, Penton E, Garcia D, Guillen G, Pujol FH: HBV genotypic variability in Cuba. PLoS One. 2015 Mar 5;10(3):e0118959. doi: 10.1371/journal.pone.0118959. eCollection 2015. [Article]
- Jeantet D, Chemin I, Mandrand B, Zoulim F, Trepo C, Kay A: Characterization of two hepatitis B virus populations isolated from a hepatitis B surface antigen-negative patient. Hepatology. 2002 May;35(5):1215-24. [Article]