Tubulin alpha-3E chain

Details

Name
Tubulin alpha-3E chain
Synonyms
  • Alpha-tubulin 3E
Gene Name
TUBA3E
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017086|Tubulin alpha-3E chain
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYSKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLVHKFDLMYAKWAFVHWYVGEGMEEGEFSE
AREDLAALEKDCEEVGVDSVEAEAEEGEAY
Number of residues
450
Molecular Weight
49858.135
Theoretical pI
4.73
GO Classification
Functions
GTP binding / GTPase activity / structural constituent of cytoskeleton
Processes
microtubule-based process
Components
cytoplasm / microtubule / nucleus
General Function
Structural constituent of cytoskeleton
Specific Function
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0017087|Tubulin alpha-3E chain (TUBA3E)
ATGCGCGAGTGTATCTCTATCCACGTGGGGCAGGCGGGTGTCCAGATCGGCAATGCCTGC
TGGGAACTGTACTGCCTTGAACATGGAATTCAGCCCGATGGTCAAATGCCAAGTGATAAA
ACCATTGGTGGCGGGGACGACTCCTTCAACACGTTCTTCAGTGAGACTGGAGCTGGCAAG
CACGTGCCCAGAGCAGTGTTTGTGGACCTGGAGCCCACTGTGGTCGATGAAGTGCGCACA
GGGACCTACAGGCAGCTCTTCCACCCAGAGCAGCTGATCACCGGGAAGGAAGATGCAGCC
AGTAATTACGCCAGGGGCCATTACACCATCGGCAAGGAGATTGTTGACCTAGTCCTGGAC
CGGATCCGCAAACTGGCGGATCTGTGCACAGGACTGCAGGGCTTCCTCATCTTCCACAGC
TTTGGGGGCGGCACTGGCTCTGGGTTCGCATCTCTGCTCATGGAGCGGCTCTCAGTGGAT
TACAGCAAGAAGTCCAAGCTAGAGTTTGCCATTTACCCAGCCCCCCAGGTCTCCACAGCC
GTGGTGGAGCCCTACAACTCCATCCTAACCACCCACACGACCCTGGAACATTCTGACTGT
GCCTTCATGGTCGACAATGAAGCCATCTATGACATATGTCGGCGCAACCTGGACATTGAA
CGTCCCACGTACACCAACCTCAATCGCCTGATTGGGCAGATCGTGTCCTCCATCACGGCC
TCCCTGCGATTTGATGGGGCCCTGAATGTGGACTTGACGGAATTCCAGACCAACCTCGTG
CCGTACCCCCGCATCCACTTCCCCCTGGCCACCTACGCCCCAGTCATCTCAGCTGAGAAG
GCCTACCACGAGCAGCTGTCTGTGGCCGAGATCACCAATGCCTGCTTCGAGCCAGCCAAT
CAGATGGTCAAGTGTGACCCTCGCCATGGCAAGTACATGGCCTGCTGCATGTTGTACAGG
GGGGACGTGGTCCCCAAAGACGTCAATGCGGCCATCGCCACCATCAAGACCAAGCGCACT
ATCCAGTTTGTGGATTGGTGCCCGACTGGATTTAAGGTGGGCATTAACTACCAGCCCCCC
ACAGTGGTCCCCGGGGGAGACCTGGCCAAGGTGCAGCGGGCCGTGTGCATGCTGAGCAAC
ACCACGGCCATTGCGGAGGCCTGGGCCCGCCTGGTCCATAAGTTCGATCTCATGTATGCC
AAGTGGGCCTTTGTGCACTGGTACGTGGGCGAAGGCATGGAAGAGGGAGAGTTCTCTGAG
GCCCGCGAGGACCTGGCAGCTCTAGAGAAGGATTGTGAAGAGGTGGGCGTGGATTCCGTG
GAAGCTGAGGCTGAAGAAGGCGAAGAATACTGA
Chromosome Location
2
Locus
2q21.1
External Identifiers
ResourceLink
UniProtKB IDQ6PEY2
UniProtKB Entry NameTBA3E_HUMAN
GenBank Gene IDBC057811
GenAtlas IDTUBA3E
HGNC IDHGNC:20765
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Rogowski K, Juge F, van Dijk J, Wloga D, Strub JM, Levilliers N, Thomas D, Bre MH, Van Dorsselaer A, Gaertig J, Janke C: Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation. Cell. 2009 Jun 12;137(6):1076-87. doi: 10.1016/j.cell.2009.05.020. [PubMed:19524510]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05147CYT997investigationalunknownDetails