Integrase

Details

Name
Integrase
Synonyms
Not Available
Gene Name
pol
Organism
Human immunodeficiency virus 1
Amino acid sequence
>lcl|BSEQ0017545|Integrase
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Number of residues
288
Molecular Weight
32226.645
Theoretical pI
Not Available
GO Classification
Functions
DNA binding / endonuclease activity / RNA-directed DNA polymerase activity / zinc ion binding
Processes
DNA integration
General Function
Zinc ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ7ZJM1
UniProtKB Entry NameQ7ZJM1_9HIV1
General References
  1. Swanson P, Devare SG, Hackett J Jr: Molecular characterization of 39 HIV isolates representing group M (subtypes A-G) and group O: sequence analysis of gag p24, pol integrase, and env gp41. AIDS Res Hum Retroviruses. 2003 Jul;19(7):625-9. [PubMed:12921095]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06817RaltegravirapprovedyesinhibitorDetails
DB08930DolutegravirapprovedyesinhibitorDetails
DB09101ElvitegravirapprovedyesinhibitorDetails
DB11799Bictegravirapproved, investigationalyesantagonistDetails