Peptide deformylase

Details

Name
Peptide deformylase
Synonyms
  • 3.5.1.88
  • def1
  • PDF
  • pdf1
  • Polypeptide deformylase
Gene Name
def
Organism
Staphylococcus aureus (strain MW2)
Amino acid sequence
>lcl|BSEQ0016511|Peptide deformylase
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKDHPLQPHTDA
VEV
Number of residues
183
Molecular Weight
20559.37
Theoretical pI
6.03
GO Classification
Functions
iron ion binding / peptide deformylase activity
Processes
translation
General Function
Peptide deformylase activity
Specific Function
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0003274|552 bp
TTAAACTTCTACAGCATCTGTATGTGGTTGTAATGGGTGATCTTTGTCAATGTGATCATA
GAACATTACACCATTTAAATGGTCAATTTCATGTTGGAAAACAATTGCTGGATATCCTTT
TAGACGTAATTGTATATCATTACCTTCGATGTCTTTGGCTTTAATTGTAATTCTATTATG
ACGGTGAACTAGACCAGCAACATTATCATCGACACTAAGGCAACCTTCACCAGTTGGTAA
ATAAGCTTCTTGAACGCTATGACTTACAATTTTTGGGTTCACAAGCATATAGTCATAAGA
TTTGCCACTGCCATCATCTGGTATTAAAACAGCAATCATACGTTTAGAAATATTAATTTG
AGGTGCAGCCAAACCAACGCCTGAACGTAAACCATATCGTTTCGCGATTTCCTCATCTTG
ACTATTTACTAAAAACTCTCTCATGGCGATTAATGTTTCTTTTTCTTCTTTAGTTAATGG
TAATTCTAACTCAGCTGCTTTTTGACGCAAAGTTGGATGACCATCTCTAATGATGTCTTT
CATTGTTAACAT
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8NX78
UniProtKB Entry NameDEF_STAAW
GenBank Protein ID21204141
GenBank Gene IDBA000033
General References
  1. Baba T, Takeuchi F, Kuroda M, Yuzawa H, Aoki K, Oguchi A, Nagai Y, Iwama N, Asano K, Naimi T, Kuroda H, Cui L, Yamamoto K, Hiramatsu K: Genome and virulence determinants of high virulence community-acquired MRSA. Lancet. 2002 May 25;359(9320):1819-27. [PubMed:12044378]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB021533-sulfino-L-alanineexperimentalunknownDetails
DB043102-[(Formyl-Hydroxy-Amino)-Methyl]-Heptanoic Acid [1-(2-Hydroxymethyl-Pyrrolidine-1-Carbonyl)-2-Methyl-Propyl]-AmideexperimentalunknownDetails