Bacterioferritin comigratory protein

Details

Name
Bacterioferritin comigratory protein
Synonyms
Not Available
Gene Name
Not Available
Organism
Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Amino acid sequence
>lcl|BSEQ0017261|Bacterioferritin comigratory protein
MTDAVLELPAATFDLPLSLSGGTQTTLRAHAGHWLVIYFYPKDSTPGCTTEGLDFNALLP
EFDKAGAKILGVSRDSVKSHDNFCAKQGFAFPLVSDGDEALCRAFDVIKEKNMYGKQVLG
IERSTFLLSPEGQVVQAWRKVKVAGHADAVLAALKAHAKQ
Number of residues
160
Molecular Weight
17277.625
Theoretical pI
7.04
GO Classification
Functions
antioxidant activity / oxidoreductase activity
General Function
Oxidoreductase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0017262|Bacterioferritin comigratory protein
ATGACCGACGCTGTACTGGAACTGCCCGCTGCAACCTTCGATCTGCCGCTGTCGCTGTCC
GGCGGCACCCAGACCACCTTGCGTGCCCATGCCGGCCACTGGCTGGTGATCTACTTCTAC
CCCAAGGACAGCACGCCCGGCTGCACCACCGAAGGCCTGGACTTCAACGCGCTGCTGCCG
GAATTCGACAAGGCCGGCGCCAAGATCCTGGGCGTCTCGCGCGATTCGGTGAAGTCGCAC
GACAACTTCTGCGCCAAGCAGGGGTTTGCATTTCCGCTGGTCAGCGATGGCGATGAAGCA
CTGTGCCGCGCCTTCGACGTGATCAAGGAAAAGAACATGTACGGCAAGCAGGTGCTCGGC
ATCGAGCGCAGCACCTTCCTGCTGTCGCCCGAGGGGCAGGTCGTGCAGGCCTGGCGCAAG
GTCAAGGTCGCCGGCCATGCCGATGCGGTGCTGGCCGCGTTGAAGGCGCACGCCAAACAG
TGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8P9V9
UniProtKB Entry NameQ8P9V9_XANCP
GenBank Protein ID21110939
GenBank Gene IDAE008922
General References
  1. Liao SJ, Yang CY, Chin KH, Wang AH, Chou SH: Insights into the alkyl peroxide reduction pathway of Xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate-ligand complex structures. J Mol Biol. 2009 Jul 31;390(5):951-66. doi: 10.1016/j.jmb.2009.05.030. Epub 2009 May 25. [PubMed:19477183]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04640Naphthalene-2,6-disulfonic acidexperimentalunknownDetails