Cyclooxygenase 2

Details

Name
Cyclooxygenase 2
Synonyms
  • COX-2
  • Prostaglandin G/H synthase-2
  • Prostaglandin-endoperoxide synthase 2
Gene Name
PTGS2
Organism
Canis lupus familiaris
Amino acid sequence
>lcl|BSEQ0051973|Cyclooxygenase 2
MLARALVLCAALAVVRAANPCCSHPCQNQGICMSTGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLYLKPTPNTVHYILTHFKGVWNIVNNIPFLRNTIMKYVLTSRSHLIESPPTYNVNY
GYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHVPEHLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFIYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDGQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
Number of residues
604
Molecular Weight
68974.625
Theoretical pI
Not Available
GO Classification
Functions
enzyme binding / heme binding / peroxidase activity / prostaglandin-endoperoxide synthase activity / protein homodimerization activity
Processes
brown fat cell differentiation / cellular response to fluid shear stress / cellular response to hypoxia / cellular response to non-ionic osmotic stress / cyclooxygenase pathway / decidualization / embryo implantation / inflammatory response / negative regulation of apoptotic process / negative regulation of cysteine-type endopeptidase activity involved in apoptotic process / negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress / positive regulation of brown fat cell differentiation / positive regulation of fever generation / positive regulation of peptidyl-serine phosphorylation / positive regulation of prostaglandin biosynthetic process / regulation of blood pressure / regulation of cell proliferation / response to oxidative stress
Components
cytoplasm / endoplasmic reticulum / neuron projection
General Function
Not Available
Specific Function
Enzyme binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0051974|Cyclooxygenase 2 (PTGS2)
ATGCTGGCCCGCGCCCTGGTGCTCTGCGCCGCCCTGGCGGTCGTCCGCGCAGCAAATCCT
TGCTGTTCCCACCCATGTCAAAACCAAGGTATTTGTATGAGCACAGGATTTGACCAGTAT
AAGTGTGACTGTACCCGAACAGGATTCTACGGCGAAAACTGCTCAACACCGGAATTTCTG
ACAAGAATAAAATTATACCTGAAACCCACTCCAAATACAGTACACTACATACTTACCCAC
TTCAAGGGAGTCTGGAACATTGTCAATAACATCCCCTTCCTGCGAAATACAATTATGAAA
TATGTGTTGACATCCCGGTCACATTTGATTGAGAGTCCACCAACTTATAATGTGAACTAC
GGCTATAAAAGCTGGGAAGCCTTTTCTAACCTCTCCTATTATACCAGAGCTCTTCCCCCT
GTACCTGATGACTGTCCAACACCCATGGGTGTGAAAGGCAAGAAAGAGCTTCCTGATTCA
AAAGAGATTGTGGAAAAGTTTCTTCTGCGAAGAAAGTTCATTCCTGATCCCCAAGGCACC
AATATGATGTTTGCATTCTTTGCCCAGCACTTTACCCATCAATTTTTCAAGACAGATCAT
AAGCGAGGACCAGCTTTCACCAAAGGATTGGGCCATGGGGTGGACTTAAATCATGTTTAT
GGGGAAACTTTGGATAGACAACATAAACTGCGCCTTTTCAAGGATGGAAAAATGAAATAT
CAGGTAATTGATGGAGAGGTGTATCCTCCTACCGTCAAAGATACTCAGGTCGAGATGATC
TACCCACCTCATGTTCCTGAACACCTGCAGTTTGCTGTGGGCCAGGAGGTCTTTGGTCTG
GTGCCTGGTCTGATGATGTATGCCACCATTTGGCTGCGGGAGCATAACAGAGTGTGTGAT
GTGCTTAAACAGGAGCACCCAGAATGGGATGATGAGCGGTTATTCCAGACGAGCAGGCTA
ATACTTATAGGAGAAACCATTAAGATTGTGATTGAAGACTATGTACAACACTTGAGTGGC
TATCACTTCAAGCTGAAGTTTGACCCAGAGCTGCTTTTCAACCAACAATTCCAGTACCAA
AACCGCATTGCTGCTGAGTTTAACACACTCTACCACTGGCATCCCCTCCTGCCTGACACC
TTGCAAATAGATGACCAGGAGTACAATTTCCAACAGTTTATCTACAACAACTCTATATTA
TTGGAACATGGCCTTACCCAGTTTGTGGAATCATTCAGCAGGCAAATTGCTGGCAGGGTT
GCCGGTGGCAGGAATGTTCCAGCTGCAGTACAACAAGTAGCAAAAGCTTCGATTGACCAG
AGCAGACAGATGAAATACCAGTCTCTTAATGAGTATCGCAAACGCTTTAGGCTGAAGCCC
TATACATCATTCGAAGAACTTACAGGAGAGAAGGAAATGGCTGCGGGGTTGGAGGCCCTT
TATGGTGATATTGATGCCATGGAGCTGTATCCTGCCCTCTTGGTAGAAAAGCCTCGTCCA
GATGCCATCTTTGGTGAGACCATGGTAGAAATGGGAGCACCATTCTCCTTGAAAGGACTT
ATGGGTAATCCCATCTGTTCACCTGACTACTGGAAGCCTAGCACCTTTGGTGGAGAAGTA
GGCTTTAAAATCATCAACACTGCCTCAATCCAGTCTCTCATCTGCAATAACGTGAAGGGC
TGTCCATTCACTGCATTCTCTGTTCAAGACGGACAACTCACCAAAACAGTCACCATTAAT
GCAAGCTCTTCGCACTCCGGTCTAGATGACATCAATCCCACAGTCCTACTGAAAGAACGG
TCAACTGAACTATAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8SPQ9
UniProtKB Entry NameQ8SPQ9_CANLF
General References
  1. Boutemmine D, Bouchard N, Boerboom D, Jones HE, Goff AK, Dore M, Sirois J: Molecular characterization of canine prostaglandin G/H synthase-2 and regulation in prostatic adenocarcinoma cells in vitro. Endocrinology. 2002 Mar;143(3):1134-43. doi: 10.1210/endo.143.3.8695. [PubMed:11861541]
  2. Lindblad-Toh K, Wade CM, Mikkelsen TS, Karlsson EK, Jaffe DB, Kamal M, Clamp M, Chang JL, Kulbokas EJ 3rd, Zody MC, Mauceli E, Xie X, Breen M, Wayne RK, Ostrander EA, Ponting CP, Galibert F, Smith DR, DeJong PJ, Kirkness E, Alvarez P, Biagi T, Brockman W, Butler J, Chin CW, Cook A, Cuff J, Daly MJ, DeCaprio D, Gnerre S, Grabherr M, Kellis M, Kleber M, Bardeleben C, Goodstadt L, Heger A, Hitte C, Kim L, Koepfli KP, Parker HG, Pollinger JP, Searle SM, Sutter NB, Thomas R, Webber C, Baldwin J, Abebe A, Abouelleil A, Aftuck L, Ait-Zahra M, Aldredge T, Allen N, An P, Anderson S, Antoine C, Arachchi H, Aslam A, Ayotte L, Bachantsang P, Barry A, Bayul T, Benamara M, Berlin A, Bessette D, Blitshteyn B, Bloom T, Blye J, Boguslavskiy L, Bonnet C, Boukhgalter B, Brown A, Cahill P, Calixte N, Camarata J, Cheshatsang Y, Chu J, Citroen M, Collymore A, Cooke P, Dawoe T, Daza R, Decktor K, DeGray S, Dhargay N, Dooley K, Dooley K, Dorje P, Dorjee K, Dorris L, Duffey N, Dupes A, Egbiremolen O, Elong R, Falk J, Farina A, Faro S, Ferguson D, Ferreira P, Fisher S, FitzGerald M, Foley K, Foley C, Franke A, Friedrich D, Gage D, Garber M, Gearin G, Giannoukos G, Goode T, Goyette A, Graham J, Grandbois E, Gyaltsen K, Hafez N, Hagopian D, Hagos B, Hall J, Healy C, Hegarty R, Honan T, Horn A, Houde N, Hughes L, Hunnicutt L, Husby M, Jester B, Jones C, Kamat A, Kanga B, Kells C, Khazanovich D, Kieu AC, Kisner P, Kumar M, Lance K, Landers T, Lara M, Lee W, Leger JP, Lennon N, Leuper L, LeVine S, Liu J, Liu X, Lokyitsang Y, Lokyitsang T, Lui A, Macdonald J, Major J, Marabella R, Maru K, Matthews C, McDonough S, Mehta T, Meldrim J, Melnikov A, Meneus L, Mihalev A, Mihova T, Miller K, Mittelman R, Mlenga V, Mulrain L, Munson G, Navidi A, Naylor J, Nguyen T, Nguyen N, Nguyen C, Nguyen T, Nicol R, Norbu N, Norbu C, Novod N, Nyima T, Olandt P, O'Neill B, O'Neill K, Osman S, Oyono L, Patti C, Perrin D, Phunkhang P, Pierre F, Priest M, Rachupka A, Raghuraman S, Rameau R, Ray V, Raymond C, Rege F, Rise C, Rogers J, Rogov P, Sahalie J, Settipalli S, Sharpe T, Shea T, Sheehan M, Sherpa N, Shi J, Shih D, Sloan J, Smith C, Sparrow T, Stalker J, Stange-Thomann N, Stavropoulos S, Stone C, Stone S, Sykes S, Tchuinga P, Tenzing P, Tesfaye S, Thoulutsang D, Thoulutsang Y, Topham K, Topping I, Tsamla T, Vassiliev H, Venkataraman V, Vo A, Wangchuk T, Wangdi T, Weiand M, Wilkinson J, Wilson A, Yadav S, Yang S, Yang X, Young G, Yu Q, Zainoun J, Zembek L, Zimmer A, Lander ES: Genome sequence, comparative analysis and haplotype structure of the domestic dog. Nature. 2005 Dec 8;438(7069):803-19. doi: 10.1038/nature04338. [PubMed:16341006]
  3. Whiteley MH, Bell JS, Rothman DA: Novel allelic variants in the canine cyclooxgenase-2 (Cox-2) promoter are associated with renal dysplasia in dogs. PLoS One. 2011 Feb 8;6(2):e16684. doi: 10.1371/journal.pone.0016684. [PubMed:21346820]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11455Robenacoxibexperimental, vet_approvedunknowninhibitorDetails
DB14059SC-236experimental, investigationalyesinhibitorDetails
DB14060NS-398experimentalyesinhibitorDetails