Stabilin-2

Details

Name
Stabilin-2
Synonyms
  • FAS1 EGF-like and X-link domain-containing adhesion molecule 2
  • Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 2
  • FEEL-2
  • FEEL2
  • FELL
  • FEX2
  • HARE
  • Hyaluronan receptor for endocytosis
Gene Name
STAB2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008726|Stabilin-2
MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT
CECYSAYTGPKCDKPIPECAALLCPENSRCSPSTEDENKLECKCLPNYRGDGKYCDPINP
CLRKICHPHAHCTYLGPNRHSCTCQEGYRGDGQVCLPVDPCQINFGNCPTKSTVCKYDGP
GQSHCECKEHYQNFVPGVGCSMTDICKSDNPCHRNANCTTVAPGRTECICQKGYVGDGLT
CYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNV
NELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDMFYTLTGKSGEIFNSDKDNQIKLKLHGG
KKKVKIIQGDIIASNGLLHILDRAMDKLEPTFESNNEQTIMTMLQPRYSKFRSLLEETNL
GHALDEDGVGGPYTIFVPNNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQLEVA
TLISTPHIRSMANQLIQFNTTDNGQILANDVAMEEIEITAKNGRIYTLTGVLIPPSIVPI
LPHRCDETKREMKLGTCVSCSLVYWSRCPANSEPTALFTHRCVYSGRFGSLKSGCARYCN
ATVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADSLGGNGTCICEEGFQGSQCQFCSD
PNKYGPRCNKKCLCVHGTCNNRIDSDGACLTGTCRDGSAGRLCDKQTSACGPYVQFCHIH
ATCEYSNGTASCICKAGYEGDGTLCSEMDPCTGLTPGGCSRNAECIKTGTGTHTCVCQQG
WTGNGRDCSEINNCLLPSAGGCHDNASCLYVGPGQNECECKKGFRGNGIDCEPITSCLEQ
TGKCHPLASCQSTSSGVWSCVCQEGYEGDGFLCYGNAAVELSFLSEAAIFNRWINNASLQ
PTLSATSNLTVLVPSQQATEDMDQDEKSFWLSQSNIPALIKYHMLLGTYRVADLQTLSSS
DMLATSLQGNFLHLAKVDGNITIEGASIVDGDNAATNGVIHIINKVLVPQRRLTGSLPNL
LMRLEQMPDYSIFRGYIIQYNLANAIEAADAYTVFAPNNNAIENYIREKKVLSLEEDVLR
YHVVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHG
LGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRCIYTSYFMGRRTLF
IGCQPKCVRTVITRECCAGFFGPQCQPCPGNAQNVCFGNGICLDGVNGTGVCECGEGFSG
TACETCTEGKYGIHCDQACSCVHGRCNQGPLGDGSCDCDVGWRGVHCDNATTEDNCNGTC
HTSANCLTNSDGTASCKCAAGFQGNGTICTAINACEISNGGCSAKADCKRTTPGRRVCTC
KAGYTGDGIVCLEINPCLENHGGCDKNAECTQTGPNQAACNCLPAYTGDGKVCTLINVCL
TKNGGCSEFAICNHTGQVERTCTCKPNYIGDGFTCRGSIYQELPKNPKTSQYFFQLQEHF
VKDLVGPGPFTVFAPLSAAFDEEARVKDWDKYGLMPQVLRYHVVACHQLLLENLKLISNA
TSLQGEPIVISVSQSTVYINNKAKIISSDIISTNGIVHIIDKLLSPKNLLITPKDNSGRI
LQNLTTLATNNGYIKFSNLIQDSGLLSVITDPIHTPVTLFWPTDQALHALPAEQQDFLFN
QDNKDKLKEYLKFHVIRDAKVLAVDLPTSTAWKTLQGSELSVKCGAGRDIGDLFLNGQTC
RIVQRELLFDLGVAYGIDCLLIDPTLGGRCDTFTTFDASGECGSCVNTPSCPRWSKPKGV
KQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY
SATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPS
CDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS
QKGTKVSCSCQKGYKGDGHSCTEIDPCADGLNGGCHEHATCKMTGPGKHKCECKSHYVGD
GLNCEPEQLPIDRCLQDNGQCHADAKCVDLHFQDTTVGVFHLRSPLGQYKLTFDKAREAC
ANEAATMATYNQLSYAQKAKYHLCSAGWLETGRVAYPTAFASQNCGSGVVGIVDYGPRPN
KSEMWDVFCYRMKDVNCTCKVGYVGDGFSCSGNLLQVLMSFPSLTNFLTEVLAYSNSSAR
GRAFLEHLTDLSIRGTLFVPQNSGLGENETLSGRDIEHHLANVSMFFYNDLVNGTTLQTR
LGSKLLITASQDPLQPTETRFVDGRAILQWDIFASNGIIHVISRPLKAPPAPVTLTHTGL
GAGIFFAIILVTGAVALAAYSYFRINRRTIGFQHFESEEDINVAALGKQQPENISNPLYE
STTSAPPEPSYDPFTDSEERQLEGNDPLRTL
Number of residues
2551
Molecular Weight
276985.63
Theoretical pI
Not Available
GO Classification
Functions
hyaluronic acid binding / low-density lipoprotein particle binding / low-density lipoprotein receptor activity / protein disulfide oxidoreductase activity / scavenger receptor activity
Processes
angiogenesis / carbohydrate metabolic process / cell adhesion / defense response to bacterium / endocytosis / glycosaminoglycan metabolic process / hyaluronan catabolic process / hyaluronan metabolic process / oxidation-reduction process / receptor-mediated endocytosis / regulation of blood coagulation / regulation of gene expression / small molecule metabolic process
Components
cytoplasm / endocytic vesicle membrane / external side of plasma membrane / integral component of plasma membrane / plasma membrane
General Function
Scavenger receptor activity
Specific Function
Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Hyaluronan receptor that binds to and mediates endocytosis of hyaluronic acid (HA). Acts also, in different species, as a primary systemic scavenger receptor for heparin (Hep), chondroitin sulfate (CS), dermatan sulfate (DS), nonglycosaminoglycan (GAG), acetylated low-density lipoprotein (AcLDL), pro-collagen propeptides and advanced glycation end products (AGE). May serve to maintain tissue integrity by supporting extracellular matrix turnover or it may contribute to maintaining fluidity of bodily liquids by resorption of hyaluronan. Counter receptor which plays an important role in lymphocyte recruitment in the hepatic vasculature. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. The proteolytically processed 190 kDa form also functions as an endocytosis receptor for heparin internalisation as well as HA and CS.
Pfam Domain Function
Transmembrane Regions
2459-2479
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0013379|Stabilin-2 (STAB2)
ATGATGCTACAACATTTAGTAATTTTTTGTCTTGGATTGGTTGTACAAAATTTCTGCTCC
CCAGCTGAAACCACAGGGCAGGCAAGAAGATGTGATAGGAAGTCTCTTCTTACAATTAGG
ACCGAGTGCCGATCCTGCGCTCTCAACCTTGGAGTCAAGTGCCCGGATGGTTACACCATG
ATTACCAGTGGCTCTGTAGGGGTTCGAGATTGCAGGTACACCTTTGAGGTCAGAACATAC
TCTCTGTCTCTCCCCGGATGCCGCCATATTTGTAGGAAGGACTATCTCCAACCTCGGTGT
TGTCCTGGCCGCTGGGGCCCAGACTGTATAGAGTGCCCAGGTGGAGCGGGGTCACCCTGC
AATGGCAGAGGCAGTTGTGCTGAAGGCATGGAAGGAAATGGAACCTGCTCCTGCCAAGAA
GGGTTTGGTGGAACAGCCTGTGAAACCTGTGCTGACGACAACTTATTTGGACCCAGCTGT
TCATCAGTGTGCAACTGTGTGCATGGGGTGTGCAACAGTGGACTAGATGGCGATGGAACC
TGTGAGTGCTACTCTGCGTACACTGGCCCCAAGTGTGACAAGCCCATCCCTGAATGTGCA
GCCTTGCTCTGCCCAGAAAATTCCAGATGTTCGCCTTCCACTGAAGATGAAAACAAACTG
GAATGCAAATGCCTTCCCAATTACCGAGGCGATGGCAAATACTGCGACCCCATCAATCCA
TGTTTACGAAAAATCTGCCACCCTCATGCTCATTGTACGTACCTGGGACCAAATCGGCAC
AGTTGTACATGCCAAGAAGGCTACCGTGGGGATGGCCAAGTGTGCTTGCCTGTGGACCCC
TGCCAAATTAACTTTGGAAACTGCCCTACAAAGTCTACAGTGTGCAAATATGATGGGCCT
GGACAGTCTCACTGCGAGTGTAAGGAGCATTACCAGAATTTCGTACCTGGAGTGGGGTGC
AGTATGACTGATATATGTAAATCAGATAACCCGTGTCATAGGAATGCAAATTGCACCACC
GTCGCACCAGGCCGAACTGAATGCATTTGCCAGAAAGGTTACGTGGGTGATGGCTTAACG
TGTTATGGAAACATTATGGAGCGACTCAGAGAATTAAATACTGAACCCAGAGGAAAATGG
CAAGGAAGGCTGACCTCTTTCATCTCACTCCTAGACAAAGCTTATGCCTGGCCACTGAGT
AAGCTGGGACCCTTCACGGTGCTGTTACCTACAGACAAGGGACTGAAAGGATTCAATGTA
AATGAGCTTTTGGTGGATAATAAAGCTGCTCAATACTTTGTGAAACTCCACATAATTGCT
GGTCAGATGAACATCGAATATATGAATAACACAGACATGTTCTACACCTTGACTGGAAAG
TCGGGGGAAATCTTCAACAGCGATAAGGACAATCAAATAAAGCTTAAACTCCATGGAGGC
AAAAAGAAGGTAAAAATTATACAAGGGGACATCATTGCTTCCAATGGGCTTCTGCACATC
CTTGACAGAGCCATGGACAAGTTAGAACCCACATTTGAGAGCAACAATGAGCAAACCATA
ATGACAATGCTACAACCAAGGTACAGCAAGTTCAGATCTTTGTTAGAGGAAACCAATTTG
GGACATGCCTTAGATGAGGATGGAGTTGGTGGACCATACACCATTTTTGTTCCAAATAAT
GAAGCATTGAATAACATGAAGGACGGCACTCTCGATTACCTCCTTTCTCCAGAGGGATCT
CGGAAGCTTCTGGAACTCGTCAGATACCACATTGTCCCATTTACCCAGCTTGAAGTGGCC
ACTCTCATCTCCACCCCTCACATCAGGAGCATGGCCAACCAGCTCATACAGTTCAACACC
ACCGACAATGGACAGATTCTGGCAAATGATGTGGCAATGGAAGAAATTGAGATCACTGCC
AAAAATGGCCGAATTTACACACTGACAGGAGTTCTCATTCCTCCCTCCATTGTCCCGATT
CTGCCCCATCGATGTGATGAAACAAAGAGAGAGATGAAACTGGGCACTTGTGTGAGCTGT
TCTCTGGTGTACTGGAGCAGATGTCCTGCTAACTCTGAGCCCACAGCACTCTTCACACAC
AGATGTGTCTACAGTGGCAGGTTTGGGAGCCTGAAGAGCGGCTGTGCCCGGTACTGCAAT
GCCACTGTGAAGATTCCAAAGTGCTGCAAAGGCTTCTATGGACCTGACTGCAACCAGTGT
CCAGGAGGCTTCTCAAATCCATGCTCAGGAAATGGACAGTGTGCAGATAGCCTCGGCGGC
AACGGGACATGCATTTGTGAGGAGGGCTTCCAAGGCTCCCAGTGTCAGTTCTGCTCTGAT
CCCAATAAATACGGACCTCGGTGTAACAAAAAATGCCTGTGCGTTCACGGAACATGCAAT
AACAGGATAGACAGCGATGGGGCCTGCCTCACTGGCACATGCAGAGACGGCTCTGCCGGG
AGACTCTGTGATAAGCAGACCTCAGCCTGTGGGCCCTACGTGCAGTTCTGTCACATCCAC
GCCACCTGTGAATACAGCAATGGGACAGCCAGTTGTATTTGCAAAGCAGGATATGAAGGA
GATGGAACTCTGTGTTCTGAGATGGACCCTTGCACAGGACTAACTCCAGGAGGCTGTAGC
CGCAATGCAGAATGCATCAAAACTGGCACGGGCACCCACACCTGCGTGTGTCAGCAGGGT
TGGACAGGGAATGGGAGAGACTGCTCGGAGATCAACAACTGCCTGCTGCCCAGTGCAGGC
GGCTGCCACGACAACGCATCCTGTTTGTATGTGGGTCCCGGGCAGAATGAGTGTGAGTGC
AAGAAAGGATTTCGAGGAAATGGGATTGACTGTGAACCAATAACTTCATGCTTGGAACAA
ACCGGGAAATGTCATCCATTGGCAAGCTGTCAATCTACTTCGTCTGGTGTCTGGAGCTGT
GTTTGTCAAGAGGGCTATGAAGGAGATGGCTTTCTGTGCTATGGAAACGCAGCAGTGGAA
TTGTCATTTCTCTCCGAAGCAGCTATATTTAACCGATGGATAAATAATGCTTCTCTACAA
CCCACACTGTCAGCCACCTCAAACCTCACTGTCCTCGTGCCTTCCCAACAAGCTACTGAG
GACATGGACCAGGATGAGAAAAGCTTCTGGTTGTCACAGAGCAATATTCCAGCCCTAATA
AAGTACCATATGCTACTAGGCACATACAGAGTGGCAGATCTGCAGACCCTGTCTTCTTCT
GACATGTTGGCAACATCTTTGCAGGGCAACTTCCTTCACTTGGCAAAGGTGGATGGGAAT
ATCACAATTGAAGGGGCCTCCATTGTCGATGGGGACAACGCAGCCACAAATGGAGTGATA
CACATCATCAACAAGGTGCTGGTCCCACAAAGACGTCTAACTGGCTCCTTACCAAACCTG
CTCATGCGGCTGGAACAGATGCCTGACTATTCCATCTTCCGGGGCTACATCATTCAATAT
AATCTGGCGAATGCAATTGAGGCTGCCGATGCCTACACAGTGTTTGCTCCAAACAACAAT
GCCATCGAGAATTACATCAGGGAGAAGAAAGTCTTGTCTCTAGAGGAGGACGTCCTCCGG
TATCATGTGGTCCTGGAGGAGAAACTCCTGAAGAATGACCTGCACAATGGCATGCATCGT
GAGACCATGCTGGGTTTCTCCTATTTCCTTAGCTTCTTTCTCCATAATGACCAGCTCTAT
GTAAATGAGGCTCCAATAAACTACACCAATGTAGCCACTGATAAGGGAGTGATCCATGGC
TTGGGAAAAGTTCTGGAAATTCAGAAGAACAGATGTGATAATAATGACACTACTATTATA
CGAGGAAGATGTAGGACATGCTCCTCAGAGCTGACCTGCCCATTCGGAACTAAATCTCTA
GGTAATGAGAAGAGGAGATGCATCTATACCTCCTATTTCATGGGAAGACGAACCCTGTTT
ATTGGGTGCCAGCCAAAATGTGTGAGAACCGTCATTACGAGAGAATGCTGTGCCGGCTTC
TTTGGCCCCCAATGCCAGCCCTGCCCAGGGAATGCCCAGAATGTCTGCTTTGGTAATGGC
ATCTGTTTGGATGGAGTGAATGGCACAGGTGTGTGTGAGTGTGGGGAGGGCTTCAGCGGC
ACAGCCTGCGAGACCTGCACCGAGGGCAAGTACGGCATCCACTGTGACCAAGCATGTTCT
TGTGTCCATGGGAGATGCAACCAAGGACCCTTGGGAGATGGCTCCTGTGACTGTGATGTT
GGCTGGCGAGGAGTGCATTGTGACAATGCAACCACAGAAGACAACTGCAATGGGACATGC
CATACCAGCGCCAACTGCCTCACCAACTCAGATGGTACAGCTTCATGCAAGTGTGCAGCA
GGATTCCAAGGAAACGGGACCATCTGCACAGCAATCAATGCCTGTGAGATCAGCAATGGA
GGTTGCTCTGCCAAGGCTGACTGTAAGAGAACCACCCCAGGAAGGCGAGTGTGCACGTGC
AAAGCAGGCTACACGGGTGATGGCATTGTGTGCCTGGAAATCAACCCGTGTTTGGAGAAC
CATGGTGGCTGTGACAAGAATGCGGAGTGCACACAGACAGGACCCAACCAGGCTGCCTGT
AACTGTTTGCCAGCATACACTGGAGATGGAAAGGTCTGCACACTCATCAATGTCTGCTTA
ACTAAAAATGGCGGCTGTAGTGAATTTGCCATCTGCAACCACACTGGGCAAGTAGAAAGG
ACTTGTACTTGCAAGCCAAACTACATTGGAGATGGATTTACCTGCCGCGGCAGCATTTAT
CAGGAGCTTCCCAAGAACCCGAAAACTTCCCAGTATTTCTTCCAGTTGCAGGAGCATTTC
GTGAAAGATCTGGTCGGCCCAGGCCCCTTCACTGTTTTTGCACCTTTATCTGCAGCCTTT
GATGAGGAAGCTCGGGTTAAAGACTGGGACAAATACGGTTTAATGCCCCAGGTTCTTCGG
TACCATGTGGTCGCCTGCCACCAGCTGCTTCTGGAAAACCTGAAATTGATCTCAAATGCT
ACTTCCCTCCAAGGAGAGCCAATAGTCATCTCCGTCTCTCAGAGCACGGTGTATATAAAC
AATAAGGCTAAGATCATATCCAGTGATATCATCAGTACTAATGGGATTGTTCATATCATA
GACAAATTGCTATCTCCCAAAAATTTGCTTATCACTCCCAAAGACAACTCTGGAAGAATT
CTGCAAAATCTTACGACTTTGGCAACAAACAATGGCTACATCAAATTTAGCAACTTAATA
CAGGACTCAGGTTTGCTGAGTGTCATCACCGATCCCATCCACACCCCAGTCACTCTCTTC
TGGCCCACCGACCAAGCCCTCCATGCCCTACCTGCTGAACAACAGGACTTCCTGTTCAAC
CAAGACAACAAGGACAAGCTGAAGGAGTATTTGAAGTTTCATGTGATACGAGATGCCAAG
GTTTTAGCTGTGGATCTTCCCACATCCACTGCCTGGAAGACCCTGCAAGGTTCAGAGCTG
AGTGTGAAATGTGGAGCTGGCAGGGACATCGGTGACCTCTTTCTGAATGGCCAAACCTGC
AGAATTGTGCAGCGGGAGCTCTTGTTTGACCTGGGTGTGGCCTACGGCATTGACTGTCTG
CTGATTGATCCCACCCTGGGGGGCCGCTGTGACACCTTTACTACTTTCGATGCCTCGGGG
GAGTGTGGGAGCTGTGTCAATACTCCCAGCTGCCCAAGGTGGAGTAAACCAAAGGGTGTG
AAGCAGAAGTGTCTCTACAACCTGCCCTTCAAGAGGAACCTGGAAGGCTGCCGGGAGCGG
TGCAGCCTGGTGATACAGATCCCCAGGTGCTGCAAGGGCTACTTCGGGCGAGACTGTCAG
GCCTGCCCTGGAGGACCAGATGCCCCGTGTAATAACCGGGGTGTCTGCCTTGATCAGTAC
TCGGCCACCGGAGAGTGTAAATGCAACACCGGCTTCAATGGGACGGCGTGTGAGATGTGC
TGGCCGGGGAGATTCGGGCCTGATTGTCTGCCCTGTGGCTGCTCAGACCACGGACAGTGC
GATGATGGCATCACGGGCTCCGGGCAGTGCCTCTGTGAAACGGGGTGGACAGGCCCCTCG
TGTGACACTCAGGCAGTTTTGCCTGCAGTGTGTACGCCTCCTTGTTCTGCTCATGCCACC
TGTAAGGAGAACAACACGTGTGAGTGTAACCTGGATTATGAAGGTGACGGAATCACATGC
ACAGTTGTGGATTTCTGCAAACAGGACAACGGGGGCTGTGCAAAGGTGGCCAGATGCTCC
CAGAAGGGCACGAAGGTCTCCTGCAGCTGCCAGAAGGGATACAAAGGGGACGGGCACAGC
TGCACAGAGATAGACCCCTGTGCAGACGGCCTTAACGGAGGGTGTCACGAGCACGCCACC
TGTAAGATGACAGGCCCGGGCAAGCACAAGTGTGAGTGTAAAAGTCACTATGTCGGAGAT
GGGCTGAACTGTGAGCCGGAGCAGCTGCCCATTGACCGCTGCTTACAGGACAATGGGCAG
TGCCATGCAGACGCCAAATGTGTCGACCTCCACTTCCAGGATACCACTGTTGGGGTGTTC
CATCTACGCTCCCCACTGGGCCAGTATAAGCTGACCTTTGACAAAGCCAGAGAGGCCTGT
GCCAACGAAGCTGCGACCATGGCAACCTACAACCAGCTCTCCTATGCCCAGAAGGCCAAG
TACCACCTGTGCTCAGCAGGCTGGCTGGAGACCGGGCGGGTTGCCTACCCCACAGCCTTC
GCCTCCCAGAACTGTGGCTCTGGTGTGGTTGGGATAGTGGACTATGGACCTAGACCCAAC
AAGAGTGAAATGTGGGATGTCTTCTGCTATCGGATGAAAGATGTGAACTGCACCTGCAAG
GTGGGCTATGTGGGAGATGGCTTCTCATGCAGTGGGAACCTGCTGCAGGTCCTGATGTCC
TTCCCCTCACTCACAAACTTCCTGACGGAAGTGCTGGCCTATTCCAACAGCTCAGCTCGA
GGCCGTGCATTTCTAGAACACCTGACTGACCTGTCCATCCGCGGCACCCTCTTTGTGCCA
CAGAACAGTGGGCTGGGGGAGAATGAGACCTTGTCTGGGCGGGACATCGAGCACCACCTC
GCCAATGTCAGCATGTTTTTCTACAATGACCTTGTCAATGGCACCACCCTGCAAACGAGG
CTGGGAAGCAAGCTGCTCATCACTGCCAGCCAGGACCCACTCCAACCGACGGAGACCAGG
TTTGTTGATGGAAGAGCCATTCTGCAGTGGGACATCTTTGCCTCCAATGGGATCATTCAT
GTCATTTCCAGGCCTTTAAAAGCACCCCCTGCCCCCGTGACCTTGACCCACACTGGCTTG
GGAGCAGGGATCTTCTTTGCCATCATCCTGGTGACTGGGGCTGTTGCCTTGGCTGCTTAC
TCCTACTTTCGGATAAACCGGAGAACAATCGGCTTCCAGCATTTTGAGTCGGAAGAGGAC
ATTAATGTTGCAGCTCTTGGCAAGCAGCAGCCTGAGAATATCTCGAACCCCTTGTATGAG
AGCACAACCTCAGCTCCCCCAGAACCTTCCTACGACCCCTTCACGGACTCTGAAGAACGG
CAGCTTGAGGGCAATGACCCCTTGAGGACACTGTGA
Chromosome Location
12
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8WWQ8
UniProtKB Entry NameSTAB2_HUMAN
HGNC IDHGNC:18629
General References
  1. Politz O, Gratchev A, McCourt PA, Schledzewski K, Guillot P, Johansson S, Svineng G, Franke P, Kannicht C, Kzhyshkowska J, Longati P, Velten FW, Johansson S, Goerdt S: Stabilin-1 and -2 constitute a novel family of fasciclin-like hyaluronan receptor homologues. Biochem J. 2002 Feb 15;362(Pt 1):155-64. [PubMed:11829752]
  2. Adachi H, Tsujimoto M: FEEL-1, a novel scavenger receptor with in vitro bacteria-binding and angiogenesis-modulating activities. J Biol Chem. 2002 Sep 13;277(37):34264-70. Epub 2002 Jun 19. [PubMed:12077138]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Zhou B, McGary CT, Weigel JA, Saxena A, Weigel PH: Purification and molecular identification of the human hyaluronan receptor for endocytosis. Glycobiology. 2003 May;13(5):339-49. Epub 2002 Dec 17. [PubMed:12626425]
  5. Harris EN, Kyosseva SV, Weigel JA, Weigel PH: Expression, processing, and glycosaminoglycan binding activity of the recombinant human 315-kDa hyaluronic acid receptor for endocytosis (HARE). J Biol Chem. 2007 Feb 2;282(5):2785-97. Epub 2006 Dec 4. [PubMed:17145755]
  6. Tamura Y, Adachi H, Osuga J, Ohashi K, Yahagi N, Sekiya M, Okazaki H, Tomita S, Iizuka Y, Shimano H, Nagai R, Kimura S, Tsujimoto M, Ishibashi S: FEEL-1 and FEEL-2 are endocytic receptors for advanced glycation end products. J Biol Chem. 2003 Apr 11;278(15):12613-7. Epub 2002 Dec 6. [PubMed:12473645]
  7. Harris EN, Weigel JA, Weigel PH: Endocytic function, glycosaminoglycan specificity, and antibody sensitivity of the recombinant human 190-kDa hyaluronan receptor for endocytosis (HARE). J Biol Chem. 2004 Aug 27;279(35):36201-9. Epub 2004 Jun 18. [PubMed:15208308]
  8. Hansen B, Longati P, Elvevold K, Nedredal GI, Schledzewski K, Olsen R, Falkowski M, Kzhyshkowska J, Carlsson F, Johansson S, Smedsrod B, Goerdt S, Johansson S, McCourt P: Stabilin-1 and stabilin-2 are both directed into the early endocytic pathway in hepatic sinusoidal endothelium via interactions with clathrin/AP-2, independent of ligand binding. Exp Cell Res. 2005 Feb 1;303(1):160-73. [PubMed:15572036]
  9. Jung MY, Park SY, Kim IS: Stabilin-2 is involved in lymphocyte adhesion to the hepatic sinusoidal endothelium via the interaction with alphaMbeta2 integrin. J Leukoc Biol. 2007 Nov;82(5):1156-65. Epub 2007 Aug 3. [PubMed:17675564]
  10. Park SY, Jung MY, Kim HJ, Lee SJ, Kim SY, Lee BH, Kwon TH, Park RW, Kim IS: Rapid cell corpse clearance by stabilin-2, a membrane phosphatidylserine receptor. Cell Death Differ. 2008 Jan;15(1):192-201. Epub 2007 Oct 26. [PubMed:17962816]
  11. Lee SJ, So IS, Park SY, Kim IS: Thymosin beta4 is involved in stabilin-2-mediated apoptotic cell engulfment. FEBS Lett. 2008 Jun 25;582(15):2161-6. doi: 10.1016/j.febslet.2008.03.058. Epub 2008 Jun 2. [PubMed:18519035]
  12. Park SY, Kang KB, Thapa N, Kim SY, Lee SJ, Kim IS: Requirement of adaptor protein GULP during stabilin-2-mediated cell corpse engulfment. J Biol Chem. 2008 Apr 18;283(16):10593-600. doi: 10.1074/jbc.M709105200. Epub 2008 Jan 29. [PubMed:18230608]
  13. Harris EN, Weigel JA, Weigel PH: The human hyaluronan receptor for endocytosis (HARE/Stabilin-2) is a systemic clearance receptor for heparin. J Biol Chem. 2008 Jun 20;283(25):17341-50. doi: 10.1074/jbc.M710360200. Epub 2008 Apr 22. [PubMed:18434317]
  14. Park SY, Kim SY, Jung MY, Bae DJ, Kim IS: Epidermal growth factor-like domain repeat of stabilin-2 recognizes phosphatidylserine during cell corpse clearance. Mol Cell Biol. 2008 Sep;28(17):5288-98. doi: 10.1128/MCB.01993-07. Epub 2008 Jun 23. [PubMed:18573870]
  15. Harris EN, Baggenstoss BA, Weigel PH: Rat and human HARE/stabilin-2 are clearance receptors for high- and low-molecular-weight heparins. Am J Physiol Gastrointest Liver Physiol. 2009 Jun;296(6):G1191-9. doi: 10.1152/ajpgi.90717.2008. Epub 2009 Apr 9. [PubMed:19359419]
  16. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  17. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08818Hyaluronic acidapproved, vet_approvedunknownbinderDetails