Phenol 2-hydroxylase component B

Details

Name
Phenol 2-hydroxylase component B
Synonyms
Not Available
Gene Name
pheA2
Organism
Geobacillus thermoglucosidasius
Amino acid sequence
>lcl|BSEQ0011859|Phenol 2-hydroxylase component B
MDDRLFRNAMGKFATGVTVITTELNGAVHGMTANAFMSVSLNPKLVLVSIGEKAKMLEKI
QQSKKYAVNILSQDQKVLSMNFAGQLEKPVDVQFEELGGLPVIKDALAQISCQVVNEVQA
GDHTLFIGEVTDIKITEQDPLLFFSGKYHQLAQNEKVETSS
Number of residues
161
Molecular Weight
17658.25
Theoretical pI
5.22
GO Classification
Functions
FMN binding / oxidoreductase activity
General Function
Oxidoreductase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005136|486 bp
ATGGACGATCGCTTATTTCGCAATGCAATGGGGAAATTTGCTACAGGGGTTACGGTAATT
ACGACGGAGCTTAACGGGGCTGTCCATGGAATGACGGCAAACGCCTTTATGTCTGTTTCC
TTAAATCCGAAACTTGTGTTGGTTTCCATTGGAGAAAAAGCGAAAATGCTGGAAAAAATT
CAACAATCGAAAAAATATGCAGTTAACATTTTGTCACAGGATCAAAAAGTGCTTTCGATG
AATTTTGCCGGACAGCTGGAAAAACCAGTAGATGTGCAATTCGAAGAGCTGGGGGGACTG
CCGGTCATTAAAGATGCTCTTGCACAAATTTCCTGCCAAGTTGTTAACGAAGTTCAAGCA
GGCGATCATACCCTTTTCATTGGGGAAGTGACAGATATAAAAATTACAGAGCAAGATCCG
CTTCTGTTTTTTAGCGGAAAATATCATCAGCTTGCCCAAAACGAAAAAGTGGAGACGTCG
AGCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9LAG2
UniProtKB Entry NameQ9LAG2_GEOTM
GenBank Gene IDAF140605
General References
  1. van den Heuvel RH, Westphal AH, Heck AJ, Walsh MA, Rovida S, van Berkel WJ, Mattevi A: Structural studies on flavin reductase PheA2 reveal binding of NAD in an unusual folded conformation and support novel mechanism of action. J Biol Chem. 2004 Mar 26;279(13):12860-7. Epub 2003 Dec 31. [PubMed:14703520]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails