Alpha-2,3-/2,8-sialyltransferase

Details

Name
Alpha-2,3-/2,8-sialyltransferase
Synonyms
  • Alpha-2,3/8-sialyltransferase
Gene Name
cst-II
Organism
Campylobacter jejuni
Amino acid sequence
>lcl|BSEQ0011502|Alpha-2,3-/2,8-sialyltransferase
MKKVIIAGNGPSLKEIDYSRLPNDFDVFRCNQFYFEDKYYLGKKCKAVFYNPILFFEQYY
TLKHLIQNQEYETELIMCSNYNQAHLENENFVKTFYDYFPDAHLGYDFFKQLKDFNAYFK
FHEIYFNQRITSGVYMCAVAIALGYKEIYLSGIDFYQNGSSYAFDTKQKNLLKLAPNFKN
DNSHYIGHSKNTDIKALEFLEKTYKIKLYCLCPNSLLANFIELAPNLNSNFIIQEKNNYT
KDILIPSSEAYGKFSKNINFKKIKIKENIYYKLIKDLLRLPSDIKHYFKGK
Number of residues
291
Molecular Weight
34544.37
Theoretical pI
9.02
GO Classification
Functions
transferase activity, transferring glycosyl groups
General Function
Transferase activity, transferring glycosyl groups
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9LAK3
UniProtKB Entry NameQ9LAK3_CAMJU
GenBank Gene IDAF130984
General References
  1. Chiu CP, Watts AG, Lairson LL, Gilbert M, Lim D, Wakarchuk WW, Withers SG, Strynadka NC: Structural analysis of the sialyltransferase CstII from Campylobacter jejuni in complex with a substrate analog. Nat Struct Mol Biol. 2004 Feb;11(2):163-70. Epub 2004 Jan 18. [PubMed:14730352]
  2. Wang PG: The charged sialic acid exhibits its power again: a new high-throughput screening technology. Nat Methods. 2006 Aug;3(8):589-90. [PubMed:16862130]
  3. Chan PH, Lairson LL, Lee HJ, Wakarchuk WW, Strynadka NC, Withers SG, McIntosh LP: NMR spectroscopic characterization of the sialyltransferase CstII from Campylobacter jejuni: histidine 188 is the general base. Biochemistry. 2009 Dec 1;48(47):11220-30. doi: 10.1021/bi901606n. [PubMed:19824695]
  4. Lee HJ, Lairson LL, Rich JR, Lameignere E, Wakarchuk WW, Withers SG, Strynadka NC: Structural and kinetic analysis of substrate binding to the sialyltransferase Cst-II from Campylobacter jejuni. J Biol Chem. 2011 Oct 14;286(41):35922-32. doi: 10.1074/jbc.M111.261172. Epub 2011 Aug 5. [PubMed:21832050]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03403Cytidine-5'-MonophosphateexperimentalunknownDetails