Alpha-2,3-/2,8-sialyltransferase
Details
- Name
- Alpha-2,3-/2,8-sialyltransferase
- Synonyms
- Alpha-2,3/8-sialyltransferase
- Gene Name
- cst-II
- Organism
- Campylobacter jejuni
- Amino acid sequence
>lcl|BSEQ0011502|Alpha-2,3-/2,8-sialyltransferase MKKVIIAGNGPSLKEIDYSRLPNDFDVFRCNQFYFEDKYYLGKKCKAVFYNPILFFEQYY TLKHLIQNQEYETELIMCSNYNQAHLENENFVKTFYDYFPDAHLGYDFFKQLKDFNAYFK FHEIYFNQRITSGVYMCAVAIALGYKEIYLSGIDFYQNGSSYAFDTKQKNLLKLAPNFKN DNSHYIGHSKNTDIKALEFLEKTYKIKLYCLCPNSLLANFIELAPNLNSNFIIQEKNNYT KDILIPSSEAYGKFSKNINFKKIKIKENIYYKLIKDLLRLPSDIKHYFKGK
- Number of residues
- 291
- Molecular Weight
- 34544.37
- Theoretical pI
- 9.02
- GO Classification
- Functionstransferase activity, transferring glycosyl groups
- General Function
- Transferase activity, transferring glycosyl groups
- Specific Function
- Not Available
- Pfam Domain Function
- CST-I (PF06002)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q9LAK3 UniProtKB Entry Name Q9LAK3_CAMJU GenBank Gene ID AF130984 - General References
- Chiu CP, Watts AG, Lairson LL, Gilbert M, Lim D, Wakarchuk WW, Withers SG, Strynadka NC: Structural analysis of the sialyltransferase CstII from Campylobacter jejuni in complex with a substrate analog. Nat Struct Mol Biol. 2004 Feb;11(2):163-70. Epub 2004 Jan 18. [Article]
- Wang PG: The charged sialic acid exhibits its power again: a new high-throughput screening technology. Nat Methods. 2006 Aug;3(8):589-90. [Article]
- Chan PH, Lairson LL, Lee HJ, Wakarchuk WW, Strynadka NC, Withers SG, McIntosh LP: NMR spectroscopic characterization of the sialyltransferase CstII from Campylobacter jejuni: histidine 188 is the general base. Biochemistry. 2009 Dec 1;48(47):11220-30. doi: 10.1021/bi901606n. [Article]
- Lee HJ, Lairson LL, Rich JR, Lameignere E, Wakarchuk WW, Withers SG, Strynadka NC: Structural and kinetic analysis of substrate binding to the sialyltransferase Cst-II from Campylobacter jejuni. J Biol Chem. 2011 Oct 14;286(41):35922-32. doi: 10.1074/jbc.M111.261172. Epub 2011 Aug 5. [Article]