Sodium- and chloride-dependent GABA transporter 2

Details

Name
Sodium- and chloride-dependent GABA transporter 2
Synonyms
  • GAT-2
  • GAT2
  • Solute carrier family 6 member 13
Gene Name
SLC6A13
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008625|Sodium- and chloride-dependent GABA transporter 2
MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQM
IVILLNVYYIIVLAWALFYLFSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENAT
SPVIEFWERRVLKISDGIQHLGALRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLI
LGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKRFYDNI
EDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMVCIPAWSLYRLGTLKGPFRERIRQLMCPAEDLPQRNPAGPSAPATPRTSLLRLTELES
HC
Number of residues
602
Molecular Weight
68008.205
Theoretical pI
Not Available
GO Classification
Functions
gamma-aminobutyric acid / neurotransmitter
Processes
gamma-aminobutyric acid transport / neurotransmitter secretion / neurotransmitter transport / synaptic transmission / transmembrane transport
Components
extracellular exosome / integral component of plasma membrane / neuron projection / plasma membrane
General Function
Neurotransmitter:sodium symporter activity
Specific Function
Sodium-dependent GABA and taurine transporter. In presynaptic terminals, regulates GABA signaling termination through GABA uptake. May also be involved in beta-alanine transport.
Pfam Domain Function
Transmembrane Regions
41-61 68-88 121-141 207-227 233-253 282-302 319-339 366-386 418-438 453-473 490-510 528-548
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0019636|Sodium- and chloride-dependent GABA transporter 2 (SLC6A13)
ATGGATAGCAGGGTCTCAGGCACAACCAGTAATGGAGAGACAAAACCAGTGTATCCAGTC
ATGGAAAAGAAGGAGGAAGATGGCACCCTGGAGCGGGGGCACTGGAACAACAAGATGGAG
TTTGTGCTGTCAGTGGCTGGGGAGATCATTGGCTTAGGCAACGTCTGGAGGTTTCCCTAT
CTCTGCTACAAAAATGGGGGAGAACACTGTATGGAGTTCCAGAAGACCAACGGCTCCCTG
AATGGTACCTCTGAGAATGCCACCTCTCCTGTCATCGAGTTCTGGGAGCGGCGGGTCTTG
AAGATCTCTGATGGGATCCAGCACCTGGGGGCCCTGCGCTGGGAGCTGGCTCTGTGCCTC
CTGCTGGCCTGGGTCATCTGCTACTTCTGCATCTGGAAGGGGGTGAAGTCCACAGGCAAG
GTGGTGTACTTCACGGCCACATTTCCTTACCTCATGCTGGTGGTCCTGTTAATTCGAGGG
GTGACGTTGCCTGGGGCAGCCCAAGGAATTCAGTTTTACCTGTACCCAAACCTCACGCGT
CTGTGGGATCCCCAGGTGTGGATGGATGCAGGCACCCAGATATTCTTCTCCTTCGCCATC
TGTCTTGGGTGCCTGACAGCCCTGGGCAGCTACAACAAGTACCACAACAACTGCTACAGG
GACTGCATCGCCCTCTGCTTCCTCAACAGCGGCACCAGCTTTGTGGCCGGCTTTGCCATC
TTCTCCATCCTGGGCTTCATGTCTCAGGAGCAGGGGGTGCCCATTTCTGAGGTGGCCGAG
TCAGGCCCTGGCCTGGCTTTCATCGCTTACCCGCGGGCTGTGGTGATGCTGCCCTTCTCT
CCTCTCTGGGCCTGCTGTTTCTTCTTCATGGTCGTTCTCCTGGGACTGGATAGCCAGTTT
GTGTGTGTAGAAAGCCTGGTGACAGCGCTGGTGGACATGTACCCTCACGTGTTCCGCAAG
AAGAACCGGAGGGAAGTCCTCATCCTTGGAGTATCTGTCGTCTCCTTCCTTGTGGGGCTG
ATCATGCTCACAGAGGGCGGAATGTACGTGTTCCAGCTCTTTGACTACTATGCGGCCAGT
GGCATGTGCCTCCTGTTCGTGGCCATCTTCGAGTCCCTCTGTGTGGCTTGGGTTTACGGA
GCCAAGCGCTTCTACGACAACATCGAAGACATGATTGGGTACAGGCCATGGCCTCTTATC
AAATACTGTTGGCTCTTCCTCACACCAGCTGTGTGCACAGCCACCTTTCTCTTCTCCCTG
ATAAAGTACACTCCGCTGACCTACAACAAGAAGTACACGTACCCGTGGTGGGGCGATGCC
CTGGGCTGGCTCCTGGCTCTGTCCTCCATGGTCTGCATTCCTGCCTGGAGCCTCTACAGA
CTCGGAACCCTCAAGGGCCCCTTCAGAGAGAGAATCCGTCAGCTCATGTGCCCAGCCGAG
GACCTGCCCCAGCGGAACCCAGCAGGACCCTCGGCTCCCGCCACCCCCAGGACCTCACTG
CTCAGACTCACAGAGCTAGAGTCTCACTGCTAG
Chromosome Location
12
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9NSD5
UniProtKB Entry NameS6A13_HUMAN
HGNC IDHGNC:11046
General References
  1. Gong Y, Zhang M, Cui L, Minuk GY: Sequence and chromosomal assignment of a human novel cDNA: similarity to gamma-aminobutyric acid transporter. Can J Physiol Pharmacol. 2001 Dec;79(12):977-84. [PubMed:11824941]
  2. Christiansen B, Meinild AK, Jensen AA, Brauner-Osborne H: Cloning and characterization of a functional human gamma-aminobutyric acid (GABA) transporter, human GAT-2. J Biol Chem. 2007 Jul 6;282(27):19331-41. Epub 2007 May 14. [PubMed:17502375]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Schlessinger A, Wittwer MB, Dahlin A, Khuri N, Bonomi M, Fan H, Giacomini KM, Sali A: High selectivity of the gamma-aminobutyric acid transporter 2 (GAT-2, SLC6A13) revealed by structure-based approach. J Biol Chem. 2012 Nov 2;287(45):37745-56. doi: 10.1074/jbc.M112.388157. Epub 2012 Aug 29. [PubMed:22932902]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08848GuvacineexperimentalunknowninhibitorDetails