S-ribosylhomocysteine lyase

Details

Name
S-ribosylhomocysteine lyase
Synonyms
  • 4.4.1.21
  • AI-2 synthesis protein
  • Autoinducer-2 production protein LuxS
Gene Name
luxS
Organism
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Amino acid sequence
>lcl|BSEQ0016434|S-ribosylhomocysteine lyase
MPDMANVESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLE
HLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGV
SELECGNYRDHDLAAARQHARDVLDQGLKVQETILLER
Number of residues
158
Molecular Weight
17394.625
Theoretical pI
5.01
GO Classification
Functions
iron ion binding / S-ribosylhomocysteine lyase activity
Processes
quorum sensing
General Function
S-ribosylhomocysteine lyase activity
Specific Function
Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the environment. The regulation of gene expression in response to changes in cell density is called quorum sensing. Catalyzes the transformation of S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016435|S-ribosylhomocysteine lyase (luxS)
ATGCCCGACATGGCAAACGTCGAATCGTTCGATCTGGACCACACCAAGGTCAAGGCTCCC
TATGTCCGCCTCGCCGGGGTCAAGACCACCCCGAAGGGTGACCAGATCTCCAAGTACGAC
CTGCGCTTCTTGCAGCCCAACCAGGGCGCCATCGACCCCGCCGCCATTCACACGCTCGAG
CACCTGCTGGCGGGCTACATGCGCGACCACCTCGAGGGCGTGGTGGACGTGTCCCCGATG
GGCTGCCGCACCGGCATGTACATGGCCGTCATCGGTGAACCCGACGAGCAGGGCGTGATG
AAAGCCTTCGAGGCGGCCCTCAAGGACACCGCCGGGCACGACCAACCCATTCCCGGCGTG
AGCGAACTCGAATGCGGCAACTACCGCGACCACGACCTCGCCGCCGCCCGCCAGCACGCC
CGCGACGTGCTCGACCAGGGGCTGAAAGTTCAGGAAACCATTCTGCTCGAACGCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9RRU8
UniProtKB Entry NameLUXS_DEIRA
GenBank Protein ID6460202
GenBank Gene IDAE000513
General References
  1. White O, Eisen JA, Heidelberg JF, Hickey EK, Peterson JD, Dodson RJ, Haft DH, Gwinn ML, Nelson WC, Richardson DL, Moffat KS, Qin H, Jiang L, Pamphile W, Crosby M, Shen M, Vamathevan JJ, Lam P, McDonald L, Utterback T, Zalewski C, Makarova KS, Aravind L, Daly MJ, Minton KW, Fleischmann RD, Ketchum KA, Nelson KE, Salzberg S, Smith HO, Venter JC, Fraser CM: Genome sequence of the radioresistant bacterium Deinococcus radiodurans R1. Science. 1999 Nov 19;286(5444):1571-7. [PubMed:10567266]
  2. Lewis HA, Furlong EB, Laubert B, Eroshkina GA, Batiyenko Y, Adams JM, Bergseid MG, Marsh CD, Peat TS, Sanderson WE, Sauder JM, Buchanan SG: A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs. Structure. 2001 Jun;9(6):527-37. [PubMed:11435117]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB021533-sulfino-L-alanineexperimentalunknownDetails