Tryptophan--tRNA ligase 2

Details

Name
Tryptophan--tRNA ligase 2
Synonyms
  • 6.1.1.2
  • TrpRS 2
  • TrpRS II
  • trpSII
  • Tryptophanyl-tRNA synthetase 2
  • Tryptophanyl-tRNA synthetase II
Gene Name
trpS2
Organism
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Amino acid sequence
>lcl|BSEQ0011311|Tryptophan--tRNA ligase 2
MPFVDLEVPTMTTPTPAATPARPRVLTGDRPTGALHLGHLAGSLQNRVRLQDEAELFVLL
ADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTTCVVQSAVPELAELTVYFLNLVT
VSHLRQNPTVKAEIAQKGYGERVPAGFFVYPVSQAADIAAFGATLVPVGDDQLPMLEQTR
EIVRRFNALYAPVLAEPQAQLSRVPRLPGLDGQAKMSKSLGNAIALGDSADEVARKVMGM
YTDPGHLRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKHLIDVLN
GVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVRRAMRLFGH
Number of residues
351
Molecular Weight
38179.35
Theoretical pI
6.64
GO Classification
Functions
ATP binding / tryptophan-tRNA ligase activity
Processes
tryptophanyl-tRNA aminoacylation
Components
cytoplasm
General Function
Tryptophan-trna ligase activity
Specific Function
Catalyzes the formation of 5'adenyl-Trp and tRNA(Trp) but with 5-fold less activity than TrpRS. Increases the solubility of the nitric oxide synthase oxygenase (nos), as well as its affinity for substrate L-arginine and its nitric-oxide synthase activity. The complex between trpS2 and nos catalyzes the regioselective nitration of tryptophan at the 4-position.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011312|Tryptophan--tRNA ligase 2 (trpS2)
ATGACCACCCCGACCCCTGCCGCTACACCTGCCCGCCCCCGCGTCCTGACCGGGGACCGG
CCCACCGGGGCGCTGCACCTCGGGCACCTCGCCGGGTCGCTGCAAAACCGGGTGCGCTTG
CAAGACGAGGCCGAGCTGTTCGTGCTGCTTGCCGACGTGCAGGCGCTCACCGACCACTTC
GACCGGCCCGAGCAGGTGCGCGAGAACGTGCTGGCGGTGGCGCTCGATTACCTCGCCGCC
GGGCTCGACCCGCAGAAGACGACCTGCGTGGTGCAGTCGGCGGTGCCCGAACTCGCCGAG
CTGACGGTCTATTTCCTCAATCTGGTCACGGTGTCGCACCTGCGCCAGAACCCCACCGTC
AAGGCCGAAATCGCGCAAAAGGGCTACGGCGAGCGGGTTCCTGCCGGGTTTTTCGTGTAT
CCGGTGTCGCAGGCCGCCGACATCGCCGCGTTCGGGGCCACGCTGGTGCCGGTGGGCGAC
GACCAGTTGCCGATGCTCGAACAGACCCGCGAAATCGTGCGGCGCTTCAATGCGCTGTAT
GCCCCGGTGCTCGCCGAGCCGCAGGCGCAGCTCAGCCGGGTGCCGCGTCTGCCGGGGCTC
GACGGGCAGGCCAAGATGAGCAAGTCGCTCGGCAACGCGATTGCGCTCGGCGACTCTGCC
GACGAGGTGGCGCGCAAGGTCATGGGCATGTACACCGACCCTGGCCACCTGCGGGCAAGT
GATCCCGGACGGGTGGAGGGCAATCCGGTCTTCACCTTCCTCGACGCCTTCGACCCCGAT
CCGGCGCGGGTGCAGGCGTTGAAAGACCAGTACCGCGCGGGCGGCCTCGGTGACGTGAAG
GTCAAAAAGCACCTGATTGACGTGCTCAACGGGGTGCTGGCTCCCATCCGCACGCGGCGC
GCCGAGTATGAGCGCGACCCCGACGCCGTGCTCCGGTTCGTCACGGAGGGCACGGCGCGG
GGCCGGGAGGTGGCGGCGCAGACGCTCGGGCAGGTGCGGCGGGCGATGCGGTTGTTTGGG
CACTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9RVD6
UniProtKB Entry NameSYW2_DEIRA
GenBank Protein ID6458825
GenBank Gene IDAE000513
General References
  1. White O, Eisen JA, Heidelberg JF, Hickey EK, Peterson JD, Dodson RJ, Haft DH, Gwinn ML, Nelson WC, Richardson DL, Moffat KS, Qin H, Jiang L, Pamphile W, Crosby M, Shen M, Vamathevan JJ, Lam P, McDonald L, Utterback T, Zalewski C, Makarova KS, Aravind L, Daly MJ, Minton KW, Fleischmann RD, Ketchum KA, Nelson KE, Salzberg S, Smith HO, Venter JC, Fraser CM: Genome sequence of the radioresistant bacterium Deinococcus radiodurans R1. Science. 1999 Nov 19;286(5444):1571-7. [PubMed:10567266]
  2. Buddha MR, Keery KM, Crane BR: An unusual tryptophanyl tRNA synthetase interacts with nitric oxide synthase in Deinococcus radiodurans. Proc Natl Acad Sci U S A. 2004 Nov 9;101(45):15881-6. Epub 2004 Nov 1. [PubMed:15520379]
  3. Buddha MR, Tao T, Parry RJ, Crane BR: Regioselective nitration of tryptophan by a complex between bacterial nitric-oxide synthase and tryptophanyl-tRNA synthetase. J Biol Chem. 2004 Nov 26;279(48):49567-70. Epub 2004 Oct 5. [PubMed:15466862]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02959Oxitriptanapproved, investigational, nutraceuticalunknownDetails