Protein-tyrosine-phosphatase

Details

Name
Protein-tyrosine-phosphatase
Synonyms
  • EC 3.1.3.48
Gene Name
PPI
Organism
Shewanella sp.
Amino acid sequence
>lcl|BSEQ0016959|Protein-tyrosine-phosphatase
MNKIYCLAVLSLTLLSPLALANTATEFDGPYVITPISGQSTAYWICDNRLKTTSIEKLQV
NRPEHCGDLPETKLSSEIKQIMPDTYLGIKKVVALSDVHGQYDVLLTLLKKQKIIDSDGN
WAFGEGHMVMTGDIFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRY
VHQRYDIATTLINRPYNKLYGADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTL
DKANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNH
IVVGHTSQERVLGLFHNKVIAVDSSIKVGKSGELLLLENNRLIRGLYDGTRETLQENSLN
Q
Number of residues
361
Molecular Weight
40814.26
Theoretical pI
6.38
GO Classification
Functions
metal ion binding / protein tyrosine phosphatase activity
General Function
Protein tyrosine phosphatase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0005865|1086 bp
ATGAATAAAATTTATTGCCTTGCAGTACTGAGTCTAACGCTGCTGAGCCCACTTGCACTT
GCCAATACTGCAACTGAGTTTGATGGCCCTTACGTGATAACACCGATATCTGGTCAAAGC
ACGGCTTACTGGATCTGTGACAATAGACTCAAAACGACCTCGATAGAAAAGCTGCAAGTA
AATCGACCCGAGCATTGTGGGGATTTACCCGAGACTAAGCTCTCAAGCGAGATTAAGCAG
ATCATGCCTGACACTTACTTAGGTATTAAAAAGGTGGTCGCGTTAAGTGATGTACACGGC
CAGTATGACGTTCTGCTGACTCTGCTTAAAAAGCAAAAGATTATTGATAGTGATGGAAAT
TGGGCCTTCGGCGAGGGGCATATGGTGATGACGGGGGATATCTTTGACCGCGGCCATCAA
GTCAATGAAGTGCTGTGGTTTATGTATCAGCTCGACCAACAAGCACGAGACGCTGGCGGC
ATGGTACATCTATTAATGGGCAATCATGAACAGATGGTACTCGGCGGTGACTTGCGCTAT
GTACACCAGCGTTATGATATAGCCACAACCCTCATTAACCGCCCCTATAACAAGCTCTAC
GGCGCAGATACTGAAATAGGTCAGTGGTTAAGAAGTAAGAACACCATTATCAAGATCAAC
GATGTGCTGTATATGCATGGTGGGATCAGCAGCGAATGGATCAGTCGAGAGCTAACCTTA
GACAAAGCGAATGCACTGTATCGAGCTAATGTGGATGCGTCGAAAAAATCACTAAAGGCG
GATGACTTACTCAATTTCCTTTTTTTTGGAAACGGACCAACTTGGTATCGAGGCTACTTT
TCAGAAACATTTACCGAAGCTGAACTGGATACCATTTTACAACACTTTAACGTTAATCAT
ATCGTGGTCGGACACACCTCCCAAGAACGGGTCTTAGGTCTATTCCACAACAAAGTCATT
GCCGTCGATAGCAGCATAAAAGTCGGTAAATCAGGTGAACTGCTATTACTGGAAAATAAC
CGGCTTATACGCGGGTTATATGACGGAACACGTGAAACACTGCAGGAAAATAGCCTTAAT
CAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9S427
UniProtKB Entry NameQ9S427_9GAMM
GenBank Gene IDAF164202
General References
  1. Tsuruta H, Mikami B, Aizono Y: Crystal structure of cold-active protein-tyrosine phosphatase from a psychrophile, Shewanella sp. J Biochem. 2005 Jan;137(1):69-77. [PubMed:15713885]
  2. Tsuruta H, Mikami B, Yamamoto C, Yamagata H: The role of group bulkiness in the catalytic activity of psychrophile cold-active protein tyrosine phosphatase. FEBS J. 2008 Sep;275(17):4317-28. doi: 10.1111/j.1742-4658.2008.06575.x. Epub 2008 Jul 18. [PubMed:18647345]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05260Gallium nitrateapproved, investigationalunknowninhibitorDetails