Matrix metalloproteinase-24

Details

Name
Matrix metalloproteinase-24
Synonyms
  • 3.4.24.-
  • Membrane-type matrix metalloproteinase 5
  • Membrane-type-5 matrix metalloproteinase
  • MMP-24
  • MT-MMP 5
  • MT5-MMP
  • MT5MMP
  • MTMMP5
Gene Name
MMP24
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012575|Matrix metalloproteinase-24
MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAG
NRAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGI
PVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVG
ELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGG
FLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIM
APFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPR
PPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTAL
RWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYK
GRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSV
NAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV
Number of residues
645
Molecular Weight
73230.93
Theoretical pI
9.58
GO Classification
Functions
calcium ion binding / enzyme activator activity / metalloendopeptidase activity / zinc ion binding
Processes
cell-cell adhesion / cell-cell adhesion mediated by cadherin / detection of temperature stimulus involved in sensory perception of pain / glial cell differentiation / neuronal stem cell population maintenance / positive regulation of catalytic activity / proteolysis
Components
extracellular exosome / integral component of plasma membrane / proteinaceous extracellular matrix / trans-Golgi network membrane
General Function
Zinc ion binding
Specific Function
Metalloprotease that mediates cleavage of N-cadherin (CDH2) and acts as a regulator of neuro-immune interactions and neural stem cell quiescence. Involved in cell-cell interactions between nociceptive neurites and mast cells, possibly by mediating cleavage of CDH2, thereby acting as a mediator of peripheral thermal nociception and inflammatory hyperalgesia. Key regulator of neural stem cells quiescence by mediating cleavage of CDH2, affecting CDH2-mediated anchorage of neural stem cells to ependymocytes in the adult subependymal zone, leading to modulate their quiescence. May play a role in axonal growth. Able to activate progelatinase A. May also be a proteoglycanase involved in degradation of proteoglycans, such as dermatan sulfate and chondroitin sulfate proteoglycans. Cleaves partially fibronectin, but not collagen type I, nor laminin (By similarity).
Pfam Domain Function
Transmembrane Regions
603-623
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0012576|Matrix metalloproteinase-24 (MMP24)
ATGCCGAGGAGCCGGGGCGGCCGCGCCGCGCCGGGGCCGCCGCCGCCGCCGCCGCCGCCG
GGCCAGGCCCCGCGCTGGAGCCGCTGGCGGGTCCCTGGGCGGCTGCTGCTGCTGCTGCTG
CCCGCGCTCTGCTGCCTCCCGGGCGCCGCGCGGGCGGCGGCGGCGGCGGCGGGGGCAGGG
AACCGGGCAGCGGTGGCGGTGGCGGTGGCGCGGGCGGACGAGGCGGAGGCGCCCTTCGCC
GGGCAGAACTGGTTAAAGTCCTATGGCTATCTGCTTCCCTATGACTCACGGGCATCTGCG
CTGCACTCAGCGAAGGCCTTGCAGTCGGCAGTCTCCACTATGCAGCAGTTTTACGGGATC
CCGGTCACCGGTGTGTTGGATCAGACAACGATCGAGTGGATGAAGAAACCCCGATGTGGT
GTCCCTGATCACCCCCACTTAAGCCGTAGGCGGAGAAACAAGCGCTATGCCCTGACTGGA
CAGAAGTGGAGGCAAAAACACATCACCTACAGCATTCACAACTATACCCCAAAAGTGGGT
GAGCTAGACACGCGGAAAGCTATTCGCCAGGCTTTCGATGTGTGGCAGAAGGTGACCCCA
CTGACCTTTGAAGAGGTGCCATACCATGAGATCAAAAGTGACCGGAAGGAGGCAGACATC
ATGATCTTTTTTGCTTCTGGTTTCCATGGCGACAGCTCCCCATTTGATGGAGAAGGGGGA
TTCCTGGCCCATGCCTACTTCCCTGGCCCAGGGATTGGAGGAGACACCCACTTTGACTCC
GATGAGCCATGGACGCTAGGAAATGCCAACCATGACGGGAACGACCTCTTCCTGGTGGCT
GTGCATGAGCTGGGCCACGCGCTGGGACTGGAGCACTCCAGCGACCCCAGCGCCATCATG
GCGCCCTTCTACCAGTACATGGAGACGCACAACTTCAAGCTGCCCCAGGACGATCTCCAG
GGCATCCAGAAGATCTATGGACCCCCAGCCGAGCCTCTGGAGCCCACAAGGCCACTCCCT
ACACTCCCCGTCCGCAGGATCCACTCACCATCGGAGAGGAAACACGAGCGCCAGCCCAGG
CCCCCTCGGCCGCCCCTCGGGGACCGGCCATCCACACCAGGCACCAAACCCAACATCTGT
GACGGCAACTTCAACACAGTGGCCCTCTTCCGGGGCGAGATGTTTGTCTTTAAGGATCGC
TGGTTCTGGCGTCTGCGCAATAACCGAGTGCAGGAGGGCTACCCCATGCAGATCGAGCAG
TTCTGGAAGGGCCTGCCTGCCCGCATCGACGCAGCCTATGAAAGGGCCGATGGGAGATTT
GTCTTCTTCAAAGGTGACAAGTATTGGGTGTTTAAGGAGGTGACGGTGGAGCCTGGGTAC
CCCCACAGCCTGGGGGAGCTGGGCAGCTGTTTGCCCCGTGAAGGCATTGACACAGCTCTG
CGCTGGGAACCTGTGGGCAAGACCTACTTTTTCAAAGGCGAGCGGTACTGGCGCTACAGC
GAGGAGCGGCGGGCCACGGACCCTGGCTACCCTAAGCCCATCACCGTGTGGAAGGGCATC
CCACAGGCTCCCCAAGGAGCCTTCATCAGCAAGGAAGGATATTACACCTATTTCTACAAG
GGCCGGGACTACTGGAAGTTTGACAACCAGAAACTGAGCGTGGAGCCAGGCTACCCGCGC
AACATCCTGCGTGACTGGATGGGCTGCAACCAGAAGGAGGTGGAGCGGCGGAAGGAGCGG
CGGCTGCCCCAGGACGACGTGGACATCATGGTGACCATCAACGATGTGCCGGGCTCCGTG
AACGCCGTGGCCGTGGTCATCCCCTGCATCCTGTCCCTCTGCATCCTGGTGCTGGTCTAC
ACCATCTTCCAGTTCAAGAACAAGACAGGCCCTCAGCCTGTCACCTACTATAAGCGGCCA
GTCCAGGAATGGGTGTGA
Chromosome Location
20
Locus
20q11.2
External Identifiers
ResourceLink
UniProtKB IDQ9Y5R2
UniProtKB Entry NameMMP24_HUMAN
GenBank Protein ID5381386
GenBank Gene IDAF131284
HGNC IDHGNC:7172
General References
  1. Llano E, Pendas AM, Freije JP, Nakano A, Knauper V, Murphy G, Lopez-Otin C: Identification and characterization of human MT5-MMP, a new membrane-bound activator of progelatinase a overexpressed in brain tumors. Cancer Res. 1999 Jun 1;59(11):2570-6. [PubMed:10363975]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00786MarimastatinvestigationalyesinhibitorDetails