Choline/ethanolaminephosphotransferase 1

Details

Name
Choline/ethanolaminephosphotransferase 1
Synonyms
  • 2.7.8.1
  • hCEPT1
Gene Name
CEPT1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004297|Choline/ethanolaminephosphotransferase 1
MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAG
RSLLEPLMQGYWEWLVRRVPSWIAPNLITIIGLSINICTTILLVFYCPTATEQAPLWAYI
ACACGLFIYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTVFVVLGTCIAVQLGTNPD
WMFFCCFAGTFMFYCAHWQTYVSGTLRFGIIDVTEVQIFIIIMHLLAVIGGPPFWQSMIP
VLNIQMKIFPALCTVAGTIFSCTNYFRVIFTGGVGKNGSTIAGTSVLSPFLHIGSVITLA
AMIYKKSAVQLFEKHPCLYILTFGFVSAKITNKLVVAHMTKSEMHLHDTAFIGPALLFLD
QYFNSFIDEYIVLWIALVFSFFDLIRYCVSVCNQIASHLHIHVFRIKVSTAHSNHH
Number of residues
416
Molecular Weight
46553.135
Theoretical pI
8.25
GO Classification
Functions
diacylglycerol cholinephosphotransferase activity / ethanolaminephosphotransferase activity / metal ion binding
Processes
CDP-choline pathway / glycerophospholipid biosynthetic process / lipid metabolic process / phosphatidylcholine biosynthetic process / phosphatidylethanolamine biosynthetic process / phospholipid metabolic process / small molecule metabolic process
Components
endoplasmic reticulum membrane / integral component of membrane / nuclear membrane
General Function
Metal ion binding
Specific Function
Catalyzes both phosphatidylcholine and phosphatidylethanolamine biosynthesis from CDP-choline and CDP-ethanolamine, respectively. Involved in protein-dependent process of phospholipid transport to distribute phosphatidyl choline to the lumenal surface. Has a higher cholinephosphotransferase activity than ethanolaminephosphotransferase activity.
Pfam Domain Function
Transmembrane Regions
87-107 115-135 186-206 209-229 239-259 283-303 317-337 365-385
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0016708|Choline/ethanolaminephosphotransferase 1 (CEPT1)
ATGAGTGGGCATCGATCAACAAGGAAAAGATGTGGAGATTCTCACCCGGAGTCCCCAGTG
GGCTTCGGGCATATGAGTACTACAGGATGTGTATTAAATAAATTGTTTCAGTTACCAACA
CCACCATTGTCAAGACACCAACTAAAGCGGCTAGAAGAACACAGATATCAAAGTGCTGGA
CGGTCCCTGCTTGAGCCCTTAATGCAAGGGTATTGGGAATGGCTCGTTAGAAGAGTTCCC
TCCTGGATTGCCCCAAATCTCATCACCATCATTGGACTGTCAATAAACATCTGTACAACT
ATTTTATTAGTCTTCTACTGCCCTACAGCTACAGAGCAGGCACCTCTGTGGGCATATATT
GCTTGTGCCTGTGGCCTTTTCATTTACCAGTCTTTGGATGCTATTGATGGGAAACAGGCA
AGAAGAACCAATAGTAGTTCTCCTCTGGGAGAACTTTTTGATCATGGCTGTGATTCACTA
TCAACAGTTTTTGTGGTTCTTGGAACTTGTATTGCAGTGCAGCTGGGGACAAACCCTGAT
TGGATGTTTTTTTGTTGTTTTGCGGGGACATTTATGTTCTATTGTGCGCACTGGCAAACG
TATGTTTCTGGAACATTGCGATTTGGAATAATTGATGTGACTGAAGTGCAAATCTTCATA
ATAATCATGCATTTGCTGGCAGTGATTGGAGGACCACCTTTTTGGCAATCTATGATTCCA
GTGCTGAATATTCAAATGAAAATTTTTCCTGCACTTTGTACTGTAGCAGGGACCATATTT
TCCTGTACAAATTACTTCCGTGTAATCTTCACAGGTGGTGTTGGCAAAAATGGATCAACA
ATAGCAGGAACAAGTGTCCTTTCTCCTTTTCTCCATATTGGATCAGTGATTACATTAGCT
GCAATGATCTACAAGAAATCTGCAGTTCAGCTTTTTGAAAAGCATCCCTGTCTTTATATA
CTGACATTTGGTTTTGTGTCTGCTAAAATCACTAATAAGCTTGTGGTTGCACACATGACG
AAAAGTGAAATGCATTTGCATGACACAGCATTCATAGGTCCGGCACTTTTGTTTCTGGAC
CAGTATTTTAACAGCTTTATTGATGAATATATTGTACTTTGGATTGCCCTGGTTTTCTCT
TTCTTTGATTTGATCCGCTACTGTGTCAGTGTTTGCAATCAGATTGCGTCTCACCTGCAC
ATACATGTCTTCAGAATCAAGGTCTCTACAGCTCATTCTAATCATCATTAA
Chromosome Location
1
Locus
1p13.3
External Identifiers
ResourceLink
UniProtKB IDQ9Y6K0
UniProtKB Entry NameCEPT1_HUMAN
GenBank Protein ID4584877
GenBank Gene IDAF068302
GenAtlas IDCEPT1
HGNC IDHGNC:24289
General References
  1. Henneberry AL, McMaster CR: Cloning and expression of a human choline/ethanolaminephosphotransferase: synthesis of phosphatidylcholine and phosphatidylethanolamine. Biochem J. 1999 Apr 15;339 ( Pt 2):291-8. [PubMed:10191259]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]
  5. Henneberry AL, Wistow G, McMaster CR: Cloning, genomic organization, and characterization of a human cholinephosphotransferase. J Biol Chem. 2000 Sep 22;275(38):29808-15. [PubMed:10893425]
  6. Wright MM, McMaster CR: PC and PE synthesis: mixed micellar analysis of the cholinephosphotransferase and ethanolaminephosphotransferase activities of human choline/ethanolamine phosphotransferase 1 (CEPT1). Lipids. 2002 Jul;37(7):663-72. [PubMed:12216837]
  7. Henneberry AL, Wright MM, McMaster CR: The major sites of cellular phospholipid synthesis and molecular determinants of Fatty Acid and lipid head group specificity. Mol Biol Cell. 2002 Sep;13(9):3148-61. [PubMed:12221122]
  8. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976]
  9. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  10. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00122Cholineapproved, nutraceuticalunknownsubstrateDetails
DB14006Choline salicylateapproved, nutraceuticalunknownsubstrateDetails