Natriuretic peptides B

Details

Name
Natriuretic peptides B
Synonyms
  • Gamma-brain natriuretic peptide
Gene Name
NPPB
Organism
Human
Amino acid sequence
>lcl|BSEQ0001949|Natriuretic peptides B
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE
QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI
SSSSGLGCKVLRRH
Number of residues
134
Molecular Weight
14725.825
Theoretical pI
11.01
GO Classification
Functions
receptor binding / hormone activity / diuretic hormone activity
Processes
cGMP biosynthetic process / body fluid secretion / regulation of vascular permeability / positive regulation of urine volume / negative regulation of angiogenesis / cell surface receptor signaling pathway / receptor guanylyl cyclase signaling pathway / regulation of vasodilation / positive regulation of renal sodium excretion / regulation of blood pressure / regulation of blood vessel size / negative regulation of cell growth
Components
protein complex / extracellular region / extracellular space
General Function
Receptor binding
Specific Function
Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0016272|Natriuretic peptides B (NPPB)
ATGGATCCCCAGACAGCACCTTCCCGGGCGCTCCTGCTCCTGCTCTTCTTGCATCTGGCT
TTCCTGGGAGGTCGTTCCCACCCGCTGGGCAGCCCCGGTTCAGCCTCGGACTTGGAAACG
TCCGGGTTACAGGAGCAGCGCAACCATTTGCAGGGCAAACTGTCGGAGCTGCAGGTGGAG
CAGACATCCCTGGAGCCCCTCCAGGAGAGCCCCCGTCCCACAGGTGTCTGGAAGTCCCGG
GAGGTAGCCACCGAGGGCATCCGTGGGCACCGCAAAATGGTCCTCTACACCCTGCGGGCA
CCACGAAGCCCCAAGATGGTGCAAGGGTCTGGCTGCTTTGGGAGGAAGATGGACCGGATC
AGCTCCTCCAGTGGCCTGGGCTGCAAAGTGCTGAGGCGGCATTAA
Chromosome Location
1
Locus
1p36.2
External Identifiers
ResourceLink
UniProtKB IDP16860
UniProtKB Entry NameANFB_HUMAN
GenBank Protein ID179515
GenBank Gene IDM31776
GenAtlas IDNPPB
HGNC IDHGNC:7940
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01136Carvedilolapproved, investigationalunknownotherDetails
DB06412Oxymetholoneapproved, illicitunknownDetails