Protein S100-P

Details

Name
Protein S100-P
Synonyms
  • MIG9
  • Migration-inducing gene 9 protein
  • Protein S100-E
  • S100 calcium-binding protein P
  • S100E
Gene Name
S100P
Organism
Humans
Amino acid sequence
>lcl|BSEQ0002369|Protein S100-P
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD
LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Number of residues
95
Molecular Weight
10399.81
Theoretical pI
4.5
GO Classification
Functions
calcium ion binding / calcium-dependent protein binding / magnesium ion binding
Processes
endothelial cell migration / response to organic substance
Components
cytoplasm / extracellular exosome / microvillus membrane / nucleus
General Function
Magnesium ion binding
Specific Function
May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the formation of microvilli in epithelial cells. May stimulate cell proliferation in an autocrine manner via activation of the receptor for activated glycation end products (RAGE).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0010829|Protein S100-P (S100P)
ATGACGGAACTAGAGACAGCCATGGGCATGATCATAGACGTCTTTTCCCGATATTCGGGC
AGCGAGGGCAGCACGCAGACCCTGACCAAGGGGGAGCTCAAGGTGCTGATGGAGAAGGAG
CTACCAGGCTTCCTGCAGAGTGGAAAAGACAAGGATGCCGTGGATAAATTGCTCAAGGAC
CTGGACGCCAATGGAGATGCCCAGGTGGACTTCAGTGAGTTCATCGTGTTCGTGGCTGCA
ATCACGTCTGCCTGTCACAAGTACTTTGAGAAGGCAGGACTCAAATGA
Chromosome Location
4
Locus
4p16
External Identifiers
ResourceLink
UniProtKB IDP25815
UniProtKB Entry NameS100P_HUMAN
GenBank Protein ID36178
GenBank Gene IDX65614
GenAtlas IDS100P
HGNC IDHGNC:10504
General References
  1. Becker T, Gerke V, Kube E, Weber K: S100P, a novel Ca(2+)-binding protein from human placenta. cDNA cloning, recombinant protein expression and Ca2+ binding properties. Eur J Biochem. 1992 Jul 15;207(2):541-7. [Article]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  3. Emoto Y, Kobayashi R, Akatsuka H, Hidaka H: Purification and characterization of a new member of the S-100 protein family from human placenta. Biochem Biophys Res Commun. 1992 Feb 14;182(3):1246-53. [Article]
  4. Koltzscher M, Neumann C, Konig S, Gerke V: Ca2+-dependent binding and activation of dormant ezrin by dimeric S100P. Mol Biol Cell. 2003 Jun;14(6):2372-84. [Article]
  5. Jin G, Wang S, Hu X, Jing Z, Chen J, Ying K, Xie Y, Mao Y: Characterization of the tissue-specific expression of the s100P gene which encodes an EF-hand Ca2+-binding protein. Mol Biol Rep. 2003 Dec;30(4):243-8. [Article]
  6. Wang G, Zhang S, Fernig DG, Spiller D, Martin-Fernandez M, Zhang H, Ding Y, Rao Z, Rudland PS, Barraclough R: Heterodimeric interaction and interfaces of S100A1 and S100P. Biochem J. 2004 Aug 15;382(Pt 1):375-83. [Article]
  7. Arumugam T, Simeone DM, Schmidt AM, Logsdon CD: S100P stimulates cell proliferation and survival via receptor for activated glycation end products (RAGE). J Biol Chem. 2004 Feb 13;279(7):5059-65. Epub 2003 Nov 14. [Article]
  8. Dowen SE, Crnogorac-Jurcevic T, Gangeswaran R, Hansen M, Eloranta JJ, Bhakta V, Brentnall TA, Luttges J, Kloppel G, Lemoine NR: Expression of S100P and its novel binding partner S100PBPR in early pancreatic cancer. Am J Pathol. 2005 Jan;166(1):81-92. [Article]
  9. Austermann J, Nazmi AR, Heil A, Fritz G, Kolinski M, Filipek S, Gerke V: Generation and characterization of a novel, permanently active S100P mutant. Biochim Biophys Acta. 2009 Jun;1793(6):1078-85. doi: 10.1016/j.bbamcr.2008.11.012. Epub 2008 Dec 8. [Article]
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  11. Yamaguchi F, Umeda Y, Shimamoto S, Tsuchiya M, Tokumitsu H, Tokuda M, Kobayashi R: S100 proteins modulate protein phosphatase 5 function: a link between CA2+ signal transduction and protein dephosphorylation. J Biol Chem. 2012 Apr 20;287(17):13787-98. doi: 10.1074/jbc.M111.329771. Epub 2012 Mar 7. [Article]
  12. Zhang H, Wang G, Ding Y, Wang Z, Barraclough R, Rudland PS, Fernig DG, Rao Z: The crystal structure at 2A resolution of the Ca2+ -binding protein S100P. J Mol Biol. 2003 Jan 24;325(4):785-94. [Article]
  13. Lee YC, Volk DE, Thiviyanathan V, Kleerekoper Q, Gribenko AV, Zhang S, Gorenstein DG, Makhatadze GI, Luxon BA: NMR structure of the Apo-S100P protein. J Biomol NMR. 2004 Jul;29(3):399-402. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01003Cromoglicic acidapprovedunknownantagonistDetails