Group IIE secretory phospholipase A2

Details

Name
Group IIE secretory phospholipase A2
Synonyms
  • 3.1.1.4
  • GIIE sPLA2
  • Phosphatidylcholine 2-acylhydrolase 2E
Gene Name
PLA2G2E
Organism
Human
Amino acid sequence
>lcl|BSEQ0012632|Group IIE secretory phospholipase A2
MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNL
GTYNRKYAHYPNKLCTGPTPPC
Number of residues
142
Molecular Weight
15988.525
Theoretical pI
8.28
GO Classification
Functions
calcium ion binding / phospholipase A2 activity
Processes
phosphatidylglycerol acyl-chain remodeling / phosphatidylinositol acyl-chain remodeling / phosphatidylserine acyl-chain remodeling / inflammatory response / small molecule metabolic process / glycerophospholipid biosynthetic process / phospholipid metabolic process / lipid catabolic process / phosphatidic acid biosynthetic process / phosphatidylcholine acyl-chain remodeling / phosphatidylethanolamine acyl-chain remodeling
Components
extracellular region
General Function
Phospholipase a2 activity
Specific Function
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a preference for arachidonic-containing phospholipids.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0012633|Group IIE secretory phospholipase A2 (PLA2G2E)
ATGAAATCTCCCCACGTGCTGGTGTTCCTTTGCCTCCTGGTGGCTCTGGTCACCGGGAAC
CTGGTTCAGTTTGGGGTGATGATCGAGAAGATGACAGGCAAGTCCGCCCTGCAGTACAAC
GACTATGGCTGTTACTGCGGCATCGGTGGCTCCCACTGGCCGGTGGACCAGACTGACTGG
TGCTGCCACGCCCACGACTGCTGCTACGGGCGTCTGGAGAAGCTGGGCTGTGAGCCCAAA
CTGGAAAAGTATCTTTTCTCTGTCAGCGAACGTGGCATTTTCTGCGCCGGCAGGACCACC
TGCCAGCGGCTGACCTGCGAGTGTGACAAGAGGGCTGCCCTCTGCTTTCGCCGCAACCTG
GGCACCTACAACCGCAAATATGCCCATTATCCCAACAAGCTGTGCACCGGGCCCACCCCG
CCCTGCTGA
Chromosome Location
1
Locus
1p36.13
External Identifiers
ResourceLink
UniProtKB IDQ9NZK7
UniProtKB Entry NamePA2GE_HUMAN
GenBank Protein ID7108923
GenBank Gene IDAF189279
HGNC IDHGNC:13414
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB019551,4-ButanediolexperimentalunknownDetails
DB02795P-Anisic AcidexperimentalunknownDetails
DB03585Oxyphenbutazoneapproved, withdrawnunknownDetails
DB09462Glycerinapproved, investigationalunknownDetails
DB00233Aminosalicylic AcidapprovedunknownunknownDetails
DB04725LicofeloneinvestigationalunknownDetails
DB06987(R)-AtenololexperimentalunknownDetails
DB026369-Hydroxy-8-Methoxy-6-Nitro-Phenanthrol[3,4-D][1,3]Dioxole-5-Carboxylic AcidexperimentalunknownDetails
DB07500(2E)-1-[2-hydroxy-4-methoxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-(4-hydroxyphenyl)prop-2-en-1-oneexperimentalunknownDetails
DB07950Indoleacetic acidexperimentalunknownDetails
DB07958(2-CARBAMOYLMETHYL-5-PROPYL-OCTAHYDRO-INDOL-7-YL)ACETIC ACIDexperimentalunknownDetails
DB02758Indolylpropionic AcidexperimentalunknownDetails
DB04743Nimesulideapproved, investigational, withdrawnunknownDetails
DB084473-{3-[(DIMETHYLAMINO)METHYL]-1H-INDOL-7-YL}PROPAN-1-OLexperimentalunknownDetails
DB02448N-Tridecanoic AcidexperimentalunknownDetails