rhMBL

Identification

Name
rhMBL
Accession Number
DB05237
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

rhMBL is a protein therapeutic being developed by Enzon for the prevention and treatment of severe infections in individuals with low levels of Mannose-Binding Lectin (MBL). Over 10 percent of the general population is estimated to be MBL-deficient. Natural MBL has an oligomeric structure (400-700 kDa), built of subunits that contain three identical peptide chains of 32 kDa each. Although MBL can form several oligomeric forms, there are indications that dimers and trimers are not biologically active and at least a tetramer form is needed for activation of complement.

Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>P11226|MBL2_HUMAN Mannose-binding protein C precursor - Homo sapiens
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
Download FASTA Format
Synonyms
  • Recombinant human mannan-binding protein
  • Recombinant human mannose-binding lectin
  • rhMBP
Categories
Not Available
UNII
Not Available
CAS number
Not Available

Pharmacology

Indication

Investigated for use/treatment in immunodeficiency and infectious and parasitic disease (unspecified).

Pharmacodynamics
Not Available
Mechanism of action

MBL deficiency may explain why some but not all individuals who are immunosuppressed develop infectious complications even when they receive prophylactic anti-infectious treatment. Studies have shown a correlation between low MBL levels and susceptibility to serious infections in patients immunosuppressed from chemotherapy, including patients with multiple myeloma undergoing high-dose chemotherapy and hematopoietic stem cell transplantation. rhMBL acts as natural MBL in the body, reducing susceptibility to serious infections.

Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
Not Available
Food Interactions
Not Available

References

General References
Not Available
External Links
UniProt
P11226
PubChem Substance
347910043
Wikipedia
Mannose_binding_lectin

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedTreatmentMultiple Myeloma (MM)1
1TerminatedTreatmentTransplantation, Liver1
1WithdrawnSupportive CareFever, Sweats, and Hot Flashes / Infection NOS / Leukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Neutropenias / Unspecified Childhood Solid Tumor, Protocol Specific1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Drug created on October 21, 2007 16:24 / Updated on August 02, 2018 05:29