Chaperone protein TorD

Details

Name
Chaperone protein TorD
Synonyms
Not Available
Gene Name
torD
Organism
Shewanella massilia
Amino acid sequence
>lcl|BSEQ0012318|Chaperone protein TorD
MSQVDINHARALVYQLLSSLFAREVDEQRLKELTSEAAQQFWEQLSLEANFTQSVDKIRS
TLNGIKDDEALLELAADYCGLFLVGTKHSASPYASLYLSGEDEPLLFGEQHQQMSEFLHQ
SKLQVQSHFPEPADHLAVMLAYMAHLFCHSENSVQLSFLQTCFNSWLAKFINHLTQCNKN
GFYSAVATLTLAWVKQDIAQLEPAVAIIS
Number of residues
209
Molecular Weight
23554.45
Theoretical pI
4.85
GO Classification
Processes
protein folding
Components
cytoplasm
General Function
Not Available
Specific Function
Involved in the biogenesis of TorA. Acts on TorA before the insertion of the molybdenum cofactor and, as a result, probably favors a conformation of the apoenzyme that is competent for acquiring the cofactor.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0006466|630 bp
ATGAGTCAAGTCGATATCAACCACGCCAGAGCCTTGGTTTATCAGCTGTTATCATCACTG
TTTGCCCGCGAAGTTGACGAGCAAAGACTTAAAGAACTCACCAGCGAAGCGGCGCAGCAA
TTTTGGGAACAGCTTAGCCTAGAAGCTAATTTCACTCAGTCAGTGGATAAAATTCGCAGC
ACGCTCAATGGGATAAAAGATGATGAGGCGTTACTCGAACTCGCGGCGGATTACTGCGGC
TTATTTCTCGTTGGCACCAAACACAGCGCTTCACCCTATGCTAGCCTGTATTTAAGTGGC
GAAGATGAACCTCTGCTATTTGGTGAGCAACATCAGCAGATGAGTGAATTTTTACACCAG
AGCAAACTGCAAGTGCAGAGTCATTTCCCTGAGCCCGCCGACCATTTGGCCGTAATGCTC
GCCTATATGGCGCACTTATTTTGTCACAGTGAAAACAGTGTCCAATTAAGCTTTTTGCAA
ACCTGCTTCAACTCTTGGTTAGCAAAATTTATTAACCACCTCACTCAATGCAACAAAAAC
GGTTTTTATAGTGCCGTTGCCACACTCACCTTAGCGTGGGTTAAGCAAGATATCGCACAG
CTTGAACCCGCTGTGGCGATAATTAGCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO87949
UniProtKB Entry NameTORD_SHEMA
GenBank Gene IDAJ006085
General References
  1. Dos Santos JP, Iobbi-Nivol C, Couillault C, Giordano G, Mejean V: Molecular analysis of the trimethylamine N-oxide (TMAO) reductase respiratory system from a Shewanella species. J Mol Biol. 1998 Nov 27;284(2):421-33. [PubMed:9813127]
  2. Tranier S, Mortier-Barriere I, Ilbert M, Birck C, Iobbi-Nivol C, Mejean V, Samama JP: Characterization and multiple molecular forms of TorD from Shewanella massilia, the putative chaperone of the molybdoenzyme TorA. Protein Sci. 2002 Sep;11(9):2148-57. [PubMed:12192070]
  3. Tranier S, Iobbi-Nivol C, Birck C, Ilbert M, Mortier-Barriere I, Mejean V, Samama JP: A novel protein fold and extreme domain swapping in the dimeric TorD chaperone from Shewanella massilia. Structure. 2003 Feb;11(2):165-74. [PubMed:12575936]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB044471,4-DithiothreitolexperimentalunknownDetails