Nuclear factor of activated T-cells, cytoplasmic 1

Details

Name
Nuclear factor of activated T-cells, cytoplasmic 1
Synonyms
  • NF-ATc
  • NF-ATc1
  • NFAT transcription complex cytosolic component
  • NFAT2
  • NFATC
Gene Name
NFATC1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008670|Nuclear factor of activated T-cells, cytoplasmic 1
MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPT
AHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRI
EITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSR
SCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPST
SPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW
LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSP
PPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGT
ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLR
NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI
PPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQ
GLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGV
ASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH
SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE
DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS
Number of residues
943
Molecular Weight
101241.73
Theoretical pI
Not Available
GO Classification
Functions
FK506 binding / mitogen-activated protein kinase p38 binding / RNA polymerase II distal enhancer sequence-specific DNA binding / RNA polymerase II transcription factor binding / transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding / transcription factor activity, sequence-specific DNA binding / transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding
Processes
calcineurin-NFAT signaling cascade / Fc-epsilon receptor signaling pathway / innate immune response / intracellular signal transduction / positive regulation of transcription from RNA polymerase II promoter / positive regulation of transcription, DNA-templated / stimulatory C-type lectin receptor signaling pathway / transcription from RNA polymerase II promoter
Components
cytoplasm / cytosol / nuclear chromatin / nucleoplasm / nucleus
General Function
Transcriptional activator activity, rna polymerase ii distal enhancer sequence-specific binding
Specific Function
Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0013343|Nuclear factor of activated T-cells, cytoplasmic 1 (NFATC1)
ATGCCAAGCACCAGCTTTCCAGTCCCTTCCAAGTTTCCACTTGGCCCTGCGGCTGCGGTC
TTCGGGAGAGGAGAAACTTTGGGGCCCGCGCCGCGCGCCGGCGGCACCATGAAGTCAGCG
GAGGAAGAACACTATGGCTATGCATCCTCCAACGTCAGCCCCGCCCTGCCGCTCCCCACG
GCGCACTCCACCCTGCCGGCCCCGTGCCACAACCTTCAGACCTCCACACCGGGCATCATC
CCGCCGGCGGATCACCCCTCGGGGTACGGAGCAGCTTTGGACGGTGGGCCCGCGGGCTAC
TTCCTCTCCTCCGGCCACACCAGGCCTGATGGGGCCCCTGCCCTGGAGAGTCCTCGCATC
GAGATAACCTCGTGCTTGGGCCTGTACCACAACAATAACCAGTTTTTCCACGATGTGGAG
GTGGAAGACGTCCTCCCTAGCTCCAAACGGTCCCCCTCCACGGCCACGCTGAGTCTGCCC
AGCCTGGAGGCCTACAGAGACCCCTCGTGCCTGAGCCCGGCCAGCAGCCTGTCCTCCCGG
AGCTGCAACTCAGAGGCCTCCTCCTACGAGTCCAACTACTCGTACCCGTACGCGTCCCCC
CAGACGTCGCCATGGCAGTCTCCCTGCGTGTCTCCCAAGACCACGGACCCCGAGGAGGGC
TTTCCCCGCGGGCTGGGGGCCTGCACACTGCTGGGTTCCCCGCGGCACTCCCCCTCCACC
TCGCCCCGCGCCAGCGTCACTGAGGAGAGCTGGCTGGGTGCCCGCTCCTCCAGACCCGCG
TCCCCTTGCAACAAGAGGAAGTACAGCCTCAACGGCCGGCAGCCGCCCTACTCACCCCAC
CACTCGCCCACGCCGTCCCCGCACGGCTCCCCGCGGGTCAGCGTGACCGACGACTCGTGG
TTGGGCAACACCACCCAGTACACCAGCTCGGCCATCGTGGCCGCCATCAACGCGCTGACC
ACCGACAGCAGCCTGGACCTGGGAGATGGCGTCCCTGTCAAGTCCCGCAAGACCACCCTG
GAGCAGCCGCCCTCAGTGGCGCTCAAGGTGGAGCCCGTCGGGGAGGACCTGGGCAGCCCC
CCGCCCCCGGCCGACTTCGCGCCCGAAGACTACTCCTCTTTCCAGCACATCAGGAAGGGC
GGCTTCTGCGACCAGTACCTGGCGGTGCCGCAGCACCCCTACCAGTGGGCGAAGCCCAAG
CCCCTGTCCCCTACGTCCTACATGAGCCCGACCCTGCCCGCCCTGGACTGGCAGCTGCCG
TCCCACTCAGGCCCGTATGAGCTTCGGATTGAGGTGCAGCCCAAGTCCCACCACCGAGCC
CACTACGAGACGGAGGGCAGCCGGGGGGCCGTGAAGGCGTCGGCCGGAGGACACCCCATC
GTGCAGCTGCATGGCTACTTGGAGAATGAGCCGCTGATGCTGCAGCTTTTCATTGGGACG
GCGGACGACCGCCTGCTGCGCCCGCACGCCTTCTACCAGGTGCACCGCATCACAGGGAAG
ACCGTGTCCACCACCAGCCACGAGGCCATCCTCTCCAACACCAAAGTCCTGGAGATCCCA
CTCCTGCCGGAGAACAGCATGCGAGCCGTCATTGACTGTGCCGGAATCCTGAAACTCAGA
AACTCCGACATTGAACTTCGGAAAGGAGAGACGGACATCGGGAGGAAGAACACACGGGTA
CGGCTGGTGTTCCGCGTTCACGTCCCGCAACCCAGCGGCCGCACGCTGTCCCTGCAGGTG
GCCTCCAACCCCATCGAATGCTCCCAGCGCTCAGCTCAGGAGCTGCCTCTGGTGGAGAAG
CAGAGCACGGACAGCTATCCGGTCGTGGGCGGGAAGAAGATGGTCCTGTCTGGCCACAAC
TTCCTGCAGGACTCCAAGGTCATTTTCGTGGAGAAAGCCCCAGATGGCCACCATGTCTGG
GAGATGGAAGCGAAAACTGACCGGGACCTGTGCAAGCCGAATTCTCTGGTGGTTGAGATC
CCGCCATTTCGGAATCAGAGGATAACCAGCCCCGTTCACGTCAGTTTCTACGTCTGCAAC
GGGAAGAGAAAGCGAAGCCAGTACCAGCGTTTCACCTACCTTCCCGCCAACGTTCCAATT
ATAAAAACAGAACCCACTGATGATTATGAGCCTGCTCCAACCTGTGGACCGGTGAGCCAG
GGGTTAAGTCCTCTCCCAAGACCATACTACAGCCAGCAGCTCGCGATGCCACCCGACCCC
AGCTCCTGCCTCGTGGCCGGCTTCCCGCCCTGTCCGCAGAGAAGCACCCTGATGCCAGCG
GCCCCTGGCGTGAGCCCCAAGCTCCACGACCTTTCTCCCGCTGCCTACACCAAGGGCGTT
GCCAGCCCGGGCCACTGTCACCTCGGACTCCCGCAGCCGGCCGGAGAGGCCCCCGCCGTC
CAGGACGTGCCCAGGCCAGTGGCCACGCACCCCGGCTCGCCCGGGCAGCCACCCCCGGCC
CTGCTGCCACAGCAGGTGAGTGCGCCTCCAAGCAGTAGCTGCCCCCCTGGTCTCGAACAC
TCGCTCTGCCCCAGCAGCCCCTCTCCTCCACTCCCGCCTGCCACCCAAGAGCCGACCTGC
CTGCAGCCCTGCAGCCCAGCGTGCCCGCCCGCCACGGGCCGCCCGCAGCACCTGCCGTCC
ACGGTCCGCAGGGACGAGTCTCCGACTGCCGGGCCACGGCTGCTGCCAGAGGTGCATGAG
GACGGTAGTCCTAATTTGGCCCCTATTCCTGTAACGGTCAAGCGAGAGCCTGAAGAGTTG
GACCAGTTGTACCTGGATGACGTAAATGAAATAATACGAAATGACCTCTCCAGCACGAGC
ACCCACTCCTAG
Chromosome Location
18
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO95644
UniProtKB Entry NameNFAC1_HUMAN
HGNC IDHGNC:7775
General References
  1. Northrop JP, Ho SN, Chen L, Thomas DJ, Timmerman LA, Nolan GP, Admon A, Crabtree GR: NF-AT components define a family of transcription factors targeted in T-cell activation. Nature. 1994 Jun 9;369(6480):497-502. [PubMed:8202141]
  2. Park J, Takeuchi A, Sharma S: Characterization of a new isoform of the NFAT (nuclear factor of activated T cells) gene family member NFATc. J Biol Chem. 1996 Aug 23;271(34):20914-21. [PubMed:8702849]
  3. Chuvpilo S, Zimmer M, Kerstan A, Glockner J, Avots A, Escher C, Fischer C, Inashkina I, Jankevics E, Berberich-Siebelt F, Schmitt E, Serfling E: Alternative polyadenylation events contribute to the induction of NF-ATc in effector T cells. Immunity. 1999 Feb;10(2):261-9. [PubMed:10072078]
  4. Vihma H, Pruunsild P, Timmusk T: Alternative splicing and expression of human and mouse NFAT genes. Genomics. 2008 Nov;92(5):279-91. doi: 10.1016/j.ygeno.2008.06.011. Epub 2008 Aug 26. [PubMed:18675896]
  5. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Lyakh L, Ghosh P, Rice NR: Expression of NFAT-family proteins in normal human T cells. Mol Cell Biol. 1997 May;17(5):2475-84. [PubMed:9111316]
  8. Beals CR, Sheridan CM, Turck CW, Gardner P, Crabtree GR: Nuclear export of NF-ATc enhanced by glycogen synthase kinase-3. Science. 1997 Mar 28;275(5308):1930-4. [PubMed:9072970]
  9. Crabtree GR: Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT. Cell. 1999 Mar 5;96(5):611-4. [PubMed:10089876]
  10. Chuvpilo S, Avots A, Berberich-Siebelt F, Glockner J, Fischer C, Kerstan A, Escher C, Inashkina I, Hlubek F, Jankevics E, Brabletz T, Serfling E: Multiple NF-ATc isoforms with individual transcriptional properties are synthesized in T lymphocytes. J Immunol. 1999 Jun 15;162(12):7294-301. [PubMed:10358178]
  11. Porter CM, Havens MA, Clipstone NA: Identification of amino acid residues and protein kinases involved in the regulation of NFATc subcellular localization. J Biol Chem. 2000 Feb 4;275(5):3543-51. [PubMed:10652349]
  12. Sheridan CM, Heist EK, Beals CR, Crabtree GR, Gardner P: Protein kinase A negatively modulates the nuclear accumulation of NF-ATc1 by priming for subsequent phosphorylation by glycogen synthase kinase-3. J Biol Chem. 2002 Dec 13;277(50):48664-76. Epub 2002 Sep 25. [PubMed:12351631]
  13. Gwack Y, Sharma S, Nardone J, Tanasa B, Iuga A, Srikanth S, Okamura H, Bolton D, Feske S, Hogan PG, Rao A: A genome-wide Drosophila RNAi screen identifies DYRK-family kinases as regulators of NFAT. Nature. 2006 Jun 1;441(7093):646-50. Epub 2006 Mar 1. [PubMed:16511445]
  14. Wolfe SA, Zhou P, Dotsch V, Chen L, You A, Ho SN, Crabtree GR, Wagner G, Verdine GL: Unusual Rel-like architecture in the DNA-binding domain of the transcription factor NFATc. Nature. 1997 Jan 9;385(6612):172-6. [PubMed:8990122]
  15. Zhou P, Sun LJ, Dotsch V, Wagner G, Verdine GL: Solution structure of the core NFATC1/DNA complex. Cell. 1998 Mar 6;92(5):687-96. [PubMed:9506523]
  16. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00852PseudoephedrineapprovedunknowninhibitorDetails