Steroid hormone receptor ERR2

Details

Name
Steroid hormone receptor ERR2
Synonyms
  • ERR beta-2
  • ERR-beta
  • ERRB2
  • ESRL2
  • Estrogen receptor-like 2
  • Estrogen-related receptor beta
  • NR3B2
  • Nuclear receptor subfamily 3 group B member 2
Gene Name
ESRRB
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008769|Steroid hormone receptor ERR2
MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPP
MFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASC
EACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRG
GRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKAL
TTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLV
YAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDL
EAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
MHKLFLEMLEAKVGQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSP
TPLNERGRQISPSTRTPGGQGKHLWLTM
Number of residues
508
Molecular Weight
56207.085
Theoretical pI
Not Available
GO Classification
Functions
RNA polymerase II distal enhancer sequence-specific DNA binding / RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding / sequence-specific DNA binding / steroid binding / steroid hormone receptor activity / transcription coactivator activity / transcription factor binding / zinc ion binding
Processes
gene expression / intracellular receptor signaling pathway / positive regulation of transcription from RNA polymerase II promoter / regulation of transcription, DNA-templated / stem cell population maintenance / transcription initiation from RNA polymerase II promoter / trophectodermal cell proliferation / trophectodermal cellular morphogenesis
Components
nucleoplasm / nucleus
General Function
Zinc ion binding
Specific Function
Nuclear receptor, may regulate ESR1 transcriptional activity. Induces the expression of PERM1 in the skeletal muscle.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0021406|Steroid hormone receptor ERR2 (ESRRB)
ATGTCCTCGGACGACAGGCACCTGGGCTCCAGCTGCGGCTCCTTCATCAAGACTGAGCCG
TCCAGCCCGTCCTCGGGCATCGATGCCCTCAGCCACCACAGCCCCAGTGGCTCGTCCGAC
GCCAGCGGCGGCTTTGGCCTGGCCCTGGGCACCCACGCCAACGGTCTGGACTCGCCACCC
ATGTTTGCAGGCGCCGGGCTGGGAGGCACCCCATGCCGCAAGAGCTACGAGGACTGTGCC
AGCGGCATCATGGAGGACTCGGCCATCAAGTGCGAGTACATGCTCAACGCCATCCCCAAG
CGCCTGTGCCTCGTGTGCGGGGACATTGCCTCTGGCTACCACTACGGCGTGGCCTCCTGC
GAGGCTTGCAAGGCCTTCTTCAAGAGGACTATCCAAGGGAACATTGAGTACAGCTGCCCG
GCCACCAACGAGTGCGAGATCACCAAACGGAGGCGCAAGTCCTGCCAGGCCTGCCGCTTC
ATGAAATGCCTCAAAGTGGGGATGCTGAAGGAAGGTGTGCGCCTTGATCGAGTGCGTGGA
GGCCGTCAGAAATACAAGCGACGGCTGGACTCAGAGAGCAGCCCATACCTGAGCTTACAA
ATTTCTCCACCTGCTAAAAAGCCATTGACCAAGATTGTCTCATACCTACTGGTGGCTGAG
CCGGACAAGCTCTATGCCATGCCTCCCCCTGGTATGCCTGAGGGGGACATCAAGGCCCTG
ACCACTCTCTGTGACCTGGCAGACCGAGAGCTTGTGGTCATCATTGGCTGGGCCAAGCAC
ATCCCAGGCTTCTCAAGCCTCTCCCTGGGGGACCAGATGAGCCTGCTGCAGAGTGCCTGG
ATGGAAATCCTCATCCTGGGCATCGTGTACCGCTCGCTGCCCTATGACGACAAGCTGGTG
TACGCTGAGGACTACATCATGGATGAGGAGCACTCCCGCCTCGCGGGGCTGCTGGAGCTC
TACCGGGCCATCCTGCAGCTGGTACGCAGGTACAAGAAGCTCAAGGTGGAGAAGGAGGAG
TTTGTGACGCTCAAGGCCCTGGCCCTCGCCAACTCCGATTCCATGTACATCGAGGATCTA
GAGGCTGTCCAGAAGCTGCAGGACCTGCTGCACGAGGCACTGCAGGACTACGAGCTGAGC
CAGCGCCATGAGGAGCCCTGGAGGACGGGCAAGCTGCTGCTGACACTGCCGCTGCTGCGG
CAGACGGCCGCCAAGGCCGTGCAGCACTTCTATAGCGTCAAACTGCAGGGCAAAGTGCCC
ATGCACAAACTCTTCCTGGAGATGCTGGAGGCCAAGGTTGGCCAAGAGCAGCTTAGAGGA
TCTCCCAAGGATGAAAGAATGTCAAGCCATGATGGAAAATGCCCCTTCCAATCAGCTGCC
TTCACAAGCAGGGATCAGAGCAACTCCCCGGGGATCCCCAATCCACGCCCTTCTAGTCCA
ACCCCCCTCAATGAGAGAGGCAGGCAGATCTCACCCAGCACTAGGACACCAGGAGGCCAG
GGAAAGCATCTCTGGCTCACCATGTAA
Chromosome Location
14
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO95718
UniProtKB Entry NameERR2_HUMAN
HGNC IDHGNC:3473
General References
  1. Chen F, Zhang Q, McDonald T, Davidoff MJ, Bailey W, Bai C, Liu Q, Caskey CT: Identification of two hERR2-related novel nuclear receptors utilizing bioinformatics and inverse PCR. Gene. 1999 Mar 4;228(1-2):101-9. [PubMed:10072763]
  2. Zhou W, Liu Z, Wu J, Liu JH, Hyder SM, Antoniou E, Lubahn DB: Identification and characterization of two novel splicing isoforms of human estrogen-related receptor beta. J Clin Endocrinol Metab. 2006 Feb;91(2):569-79. Epub 2005 Dec 6. [PubMed:16332939]
  3. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Bombail V, Collins F, Brown P, Saunders PT: Modulation of ER alpha transcriptional activity by the orphan nuclear receptor ERR beta and evidence for differential effects of long- and short-form splice variants. Mol Cell Endocrinol. 2010 Jan 15;314(1):53-61. doi: 10.1016/j.mce.2009.09.007. Epub 2009 Sep 13. [PubMed:19755138]
  6. Cho Y, Hazen BC, Russell AP, Kralli A: Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells. J Biol Chem. 2013 Aug 30;288(35):25207-18. doi: 10.1074/jbc.M113.489674. Epub 2013 Jul 8. [PubMed:23836911]
  7. Gearhart MD, Holmbeck SM, Evans RM, Dyson HJ, Wright PE: Monomeric complex of human orphan estrogen related receptor-2 with DNA: a pseudo-dimer interface mediates extended half-site recognition. J Mol Biol. 2003 Apr 4;327(4):819-32. [PubMed:12654265]
  8. Bombail V, MacPherson S, Critchley HO, Saunders PT: Estrogen receptor related beta is expressed in human endometrium throughout the normal menstrual cycle. Hum Reprod. 2008 Dec;23(12):2782-90. doi: 10.1093/humrep/den298. Epub 2008 Sep 4. [PubMed:18775884]
  9. Wilson BJ, Tremblay AM, Deblois G, Sylvain-Drolet G, Giguere V: An acetylation switch modulates the transcriptional activity of estrogen-related receptor alpha. Mol Endocrinol. 2010 Jul;24(7):1349-58. doi: 10.1210/me.2009-0441. Epub 2010 May 19. [PubMed:20484414]
  10. Collin RW, Kalay E, Tariq M, Peters T, van der Zwaag B, Venselaar H, Oostrik J, Lee K, Ahmed ZM, Caylan R, Li Y, Spierenburg HA, Eyupoglu E, Heister A, Riazuddin S, Bahat E, Ansar M, Arslan S, Wollnik B, Brunner HG, Cremers CW, Karaguzel A, Ahmad W, Cremers FP, Vriend G, Friedman TB, Riazuddin S, Leal SM, Kremer H: Mutations of ESRRB encoding estrogen-related receptor beta cause autosomal-recessive nonsyndromic hearing impairment DFNB35. Am J Hum Genet. 2008 Jan;82(1):125-38. doi: 10.1016/j.ajhg.2007.09.008. [PubMed:18179891]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00255Diethylstilbestrolapproved, investigationalunknownDetails
DB07776Flavoneapproved, experimentalunknownagonistDetails
DB01645GenisteininvestigationalunknownagonistDetails