Flavodoxin

Details

Name
Flavodoxin
Synonyms
Not Available
Gene Name
Not Available
Organism
Clostridium beijerinckii
Amino acid sequence
>lcl|BSEQ0016564|Flavodoxin
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMGDEV
LEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNE
PDEAEQDCIEFGKKIANI
Number of residues
138
Molecular Weight
15332.225
Theoretical pI
3.93
GO Classification
Functions
electron carrier activity / FMN binding
Processes
oxidation-reduction process
General Function
Fmn binding
Specific Function
Low-potential electron donor to a number of redox enzymes.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00322
UniProtKB Entry NameFLAV_CLOBE
General References
  1. Tanka M, Haniu M, Yasunobu F, Mayhew SG: The amino acid sequence of the Clostridium MP flavodoxin. J Biol Chem. 1974 Jul 25;249(14):4393-6. [PubMed:4843142]
  2. Burnett RM, Darling GD, Kendall DS, LeQuesne ME, Mayhew SG, Smith WW, Ludwig ML: The structure of the oxidized form of clostridial flavodoxin at 1.9-A resolution. J Biol Chem. 1974 Jul 25;249(14):4383-92. [PubMed:4843141]
  3. Ludwig ML, Pattridge KA, Metzger AL, Dixon MM, Eren M, Feng Y, Swenson RP: Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes. Biochemistry. 1997 Feb 11;36(6):1259-80. [PubMed:9063874]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails