Semenogelin-1
Details
- Name
- Semenogelin-1
- Synonyms
- Cancer/testis antigen 103
- Semenogelin I
- SEMG
- SGI
- Gene Name
- SEMG1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0009862|Semenogelin-1 MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESK GSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSK GHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSG AQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCP AHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHY GENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSH EQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT
- Number of residues
- 462
- Molecular Weight
- 52130.885
- Theoretical pI
- Not Available
- GO Classification
- Functionsmetal ion binding / structural molecule activityProcessesantibacterial humoral response / cellular protein metabolic process / coagulation / insemination / negative regulation of calcium ion import / negative regulation of sperm motility / positive regulation of serine-type endopeptidase activity / protein heterooligomerizationComponentsextracellular exosome / extracellular region / extracellular space / nucleus / protein complex / secretory granule
- General Function
- Structural molecule activity
- Specific Function
- Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.Alpha-inhibin-92 and alpha-inhibin-31, derived from the proteolytic degradation of semenogelin, inhibit the secretion of pituitary follicle-stimulating hormone.
- Pfam Domain Function
- Semenogelin (PF05474)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0020903|Semenogelin-1 (SEMG1) ATGAAGCCCAACATCATCTTTGTACTTTCCCTGCTCCTCATCTTGGAGAAGCAAGCAGCT GTGATGGGACAAAAAGGTGGATCAAAAGGCCGATTACCAAGTGAATTTTCCCAATTTCCA CACGGACAAAAGGGCCAGCACTATTCTGGACAAAAAGGCAAGCAACAAACTGAATCCAAA GGCAGTTTTTCTATTCAATACACATATCATGTAGATGCCAATGATCATGACCAGTCCCGA AAAAGTCAGCAATATGATTTGAATGCCCTACATAAGACGACAAAATCACAACGACATCTA GGTGGAAGTCAACAACTGCTCCATAATAAACAAGAAGGCAGAGACCATGATAAATCAAAA GGTCATTTTCACAGGGTAGTTATACACCATAAAGGAGGCAAAGCTCATCGTGGGACACAA AATCCTTCTCAAGATCAGGGGAATAGCCCATCTGGAAAGGGAATATCCAGTCAATATTCA AACACAGAAGAAAGGCTGTGGGTTCATGGACTAAGTAAAGAACAAACTTCCGTCTCTGGT GCACAAAAAGGTAGAAAACAAGGCGGATCCCAAAGCAGTTATGTTCTCCAAACTGAAGAG CTAGTAGCTAACAAACAACAACGTGAGACTAAAAATTCTCATCAAAATAAAGGGCATTAC CAAAATGTGGTTGAAGTGAGAGAGGAACATTCAAGTAAAGTACAAACCTCACTCTGTCCT GCGCACCAAGACAAACTCCAACATGGATCCAAAGACATTTTTTCTACCCAAGATGAGCTC CTAGTATATAACAAGAATCAACACCAGACAAAAAATCTCAATCAAGATCAACAGCATGGC CGAAAGGCAAATAAAATATCATACCAATCTTCAAGTACAGAAGAAAGACGACTCCACTAT GGAGAAAATGGTGTGCAGAAAGATGTATCCCAAAGCAGTATTTATAGCCAAACTGAAGAG AAAGCACAGGGCAAGTCTCAAAAACAGATAACAATTCCCAGTCAAGAGCAAGAGCATAGC CAAAAGGCAAATAAAATATCATACCAATCTTCAAGTACGGAAGAAAGACGACTCCACTAT GGAGAAAATGGTGTGCAGAAAGATGTATCCCAACGCAGTATTTATAGCCAAACTGAAAAG CTAGTAGCAGGCAAGTCTCAAATCCAGGCACCAAATCCTAAGCAAGAGCCATGGCATGGT GAAAATGCAAAAGGAGAGTCTGGCCAATCTACAAATAGAGAACAAGACCTACTCAGTCAT GAACAAAAAGGCAGACACCAACATGGATCTCATGGGGGATTGGATATTGTAATTATAGAG CAGGAAGATGACAGTGATCGTCATTTGGCACAACATCTTAACAACGACCGAAACCCATTA TTTACATAA
- Chromosome Location
- 20
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P04279 UniProtKB Entry Name SEMG1_HUMAN HGNC ID HGNC:10742 - General References
- Lilja H, Abrahamsson PA, Lundwall A: Semenogelin, the predominant protein in human semen. Primary structure and identification of closely related proteins in the male accessory sex glands and on the spermatozoa. J Biol Chem. 1989 Jan 25;264(3):1894-900. [Article]
- Ulvsback M, Lazure C, Lilja H, Spurr NK, Rao VV, Loffler C, Hansmann I, Lundwall A: Gene structure of semenogelin I and II. The predominant proteins in human semen are encoded by two homologous genes on chromosome 20. J Biol Chem. 1992 Sep 5;267(25):18080-4. [Article]
- Jensen-Seaman MI, Li WH: Evolution of the hominoid semenogelin genes, the major proteins of ejaculated semen. J Mol Evol. 2003 Sep;57(3):261-70. [Article]
- Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Kingan SB, Tatar M, Rand DM: Reduced polymorphism in the chimpanzee semen coagulating protein, semenogelin I. J Mol Evol. 2003 Aug;57(2):159-69. [Article]
- Lilja H, Jeppsson JO: Amino acid sequence of the predominant basic protein in human seminal plasma. FEBS Lett. 1985 Mar 11;182(1):181-4. [Article]
- Seidah NG, Ramasharma K, Sairam MR, Chretien M: Partial amino acid sequence of a human seminal plasma peptide with inhibin-like activity. FEBS Lett. 1984 Feb 13;167(1):98-102. [Article]
- Ramasharma K, Sairam MR, Seidah NG, Chretien M, Manjunath P, Schiller PW, Yamashiro D, Li CH: Isolation, structure, and synthesis of a human seminal plasma peptide with inhibin-like activity. Science. 1984 Mar 16;223(4641):1199-202. [Article]
- Schneider K, Kausler W, Tripier D, Jouvenal K, Spiteller G: [Isolation and structure determination of two peptides occurring in human seminal plasma]. Biol Chem Hoppe Seyler. 1989 Apr;370(4):353-6. [Article]
- Khan Z, Smyth DG: Isolation and identification of N-terminally extended forms of 5-oxoprolylglutamylprolinamide (Glp-Glu-Pro-NH2), a thyrotropin-releasing-hormone (TRH)-like peptide present in human semen. Eur J Biochem. 1993 Feb 15;212(1):35-40. [Article]
- Li CH, Hammonds RG Jr, Ramasharma K, Chung D: Human seminal alpha inhibins: isolation, characterization, and structure. Proc Natl Acad Sci U S A. 1985 Jun;82(12):4041-4. [Article]
- Robert M, Gagnon C: Semenogelin I: a coagulum forming, multifunctional seminal vesicle protein. Cell Mol Life Sci. 1999 Jun;55(6-7):944-60. [Article]
- Wang Z, Widgren EE, Sivashanmugam P, O'Rand MG, Richardson RT: Association of eppin with semenogelin on human spermatozoa. Biol Reprod. 2005 May;72(5):1064-70. Epub 2004 Dec 8. [Article]
- Wang Z, Widgren EE, Richardson RT, O'Rand MG: Characterization of an eppin protein complex from human semen and spermatozoa. Biol Reprod. 2007 Sep;77(3):476-84. Epub 2007 Jun 13. [Article]
- Mitra A, Richardson RT, O'Rand MG: Analysis of recombinant human semenogelin as an inhibitor of human sperm motility. Biol Reprod. 2010 Mar;82(3):489-96. doi: 10.1095/biolreprod.109.081331. Epub 2009 Nov 4. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01593 Zinc approved, investigational unknown Details DB14487 Zinc acetate approved, investigational unknown Details DB14533 Zinc chloride approved, investigational unknown cofactor Details DB14548 Zinc sulfate, unspecified form approved, experimental unknown cofactor Details