Coagulation factor XIII B chain

Details

Name
Coagulation factor XIII B chain
Synonyms
  • Fibrin-stabilizing factor B subunit
  • Protein-glutamine gamma-glutamyltransferase B chain
  • Transglutaminase B chain
Gene Name
F13B
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049862|Coagulation factor XIII B chain
MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCL
AGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCAS
GYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYEC
ATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFF
CHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHI
ECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKV
TYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSS
VEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGD
LIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTV
DTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDF
DNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLR
T
Number of residues
661
Molecular Weight
75510.1
Theoretical pI
Not Available
GO Classification
Processes
blood coagulation
Components
extracellular region
General Function
The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin.
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049863|Coagulation factor XIII B chain (F13B)
ATGAGGTTGAAAAACCTGACTTTTATCATCATATTGATAATCTCAGGAGAACTCTATGCA
GAAGAGAAACCCTGTGGTTTTCCTCATGTGGAAAATGGAAGAATTGCCCAATATTACTAT
ACTTTTAAAAGCTTTTACTTTCCAATGAGCATAGACAAAAAATTGTCATTTTTCTGCTTG
GCTGGTTATACCACTGAAAGTGGAAGACAAGAAGAGCAAACCACGTGTACAACAGAAGGC
TGGTCTCCAGAGCCAAGGTGCTTCAAAAAATGCACTAAGCCTGACCTGAGTAATGGTTAC
ATCTCTGATGTAAAGTTATTGTATAAAATTCAAGAGAACATGCGTTATGGTTGCGCTTCA
GGGTACAAAACCACTGGAGGGAAGGATGAAGAAGTGGTTCAATGTCTCTCTGATGGATGG
TCTTCTCAACCAACCTGTAGGAAAGAACATGAAACATGTTTGGCTCCTGAATTATATAAT
GGAAATTATTCCACAACACAGAAAACATTCAAAGTGAAGGACAAAGTACAATACGAATGT
GCTACTGGCTACTACACAGCTGGAGGAAAGAAGACAGAGGAGGTAGAATGTCTCACATAC
GGATGGTCTCTCACACCAAAATGTACCAAATTAAAGTGCTCTTCTTTAAGATTAATTGAA
AATGGTTATTTTCATCCTGTAAAGCAAACCTATGAAGAAGGAGATGTCGTTCAGTTTTTC
TGTCATGAAAATTATTATCTAAGTGGATCTGATTTAATTCAATGCTATAACTTTGGTTGG
TACCCAGAATCTCCTGTATGCGAAGGAAGAAGAAACAGATGTCCTCCTCCACCTCTGCCC
ATAAACTCCAAAATTCAAACACATTCAACAACTTATCGTCATGGAGAAATAGTTCATATA
GAATGTGAACTTAATTTTGAGATCCATGGGTCAGCAGAAATACGTTGTGAAGATGGAAAA
TGGACAGAACCTCCAAAATGCATTGAAGGACAGGAGAAGGTAGCCTGTGAGGAACCACCC
TTCATTGAAAATGGTGCAGCAAATTTACACTCTAAGATTTATTACAATGGGGATAAAGTG
ACATATGCATGTAAAAGCGGCTACCTTCTCCATGGATCGAATGAGATAACTTGTAATCGT
GGAAAATGGACACTTCCTCCTGAGTGTGTTGAAAATAATGAGAATTGTAAGCATCCTCCT
GTTGTAATGAATGGGGCTGTTGCAGACGGGATATTGGCAAGCTATGCAACAGGATCCTCA
GTGGAATATAGATGCAATGAATATTACTTACTGAGGGGATCAAAAATATCTCGTTGCGAA
CAAGGAAAATGGTCATCCCCACCTGTTTGCTTGGAACCATGTACTGTTAATGTGGATTAC
ATGAACAGAAATAACATAGAAATGAAGTGGAAATATGAAGGGAAAGTCTTACATGGAGAT
TTAATAGATTTTGTATGTAAACAGGGATATGACTTATCTCCATTAACCCCATTGTCTGAA
TTATCTGTGCAGTGCAACAGAGGAGAAGTGAAATATCCTTTATGTACTAGAAAAGAATCT
AAAGGAATGTGCACATCTCCTCCTCTTATTAAACATGGAGTCATTATTAGTTCAACAGTA
GACACCTATGAAAATGGCTCTTCAGTAGAATACAGATGTTTTGATCACCATTTCCTAGAA
GGATCTAGGGAGGCCTATTGTTTAGATGGAATGTGGACTACACCACCATTGTGTTTAGAG
CCATGCACATTATCTTTTACTGAAATGGAAAAGAATAATTTACTTCTGAAATGGGATTTT
GACAATAGACCACACATTTTGCATGGTGAATATATTGAGTTTATTTGTAGAGGAGATACT
TATCCAGCTGAATTATATATTACTGGATCTATACTTAGAATGCAATGTGACAGAGGGCAG
TTAAAATATCCAAGATGTATTCCAAGACAAAGCACTCTGTCTTATCAAGAACCCTTAAGA
ACATAG
Chromosome Location
1
Locus
1q31.3
External Identifiers
ResourceLink
UniProtKB IDP05160
UniProtKB Entry NameF13B_HUMAN
HGNC IDHGNC:3534
General References
  1. Bottenus RE, Ichinose A, Davie EW: Nucleotide sequence of the gene for the b subunit of human factor XIII. Biochemistry. 1990 Dec 25;29(51):11195-209. [PubMed:2271707]
  2. Ichinose A, McMullen BA, Fujikawa K, Davie EW: Amino acid sequence of the b subunit of human factor XIII, a protein composed of ten repetitive segments. Biochemistry. 1986 Aug 12;25(16):4633-8. [PubMed:3021194]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  5. Grundmann U, Nerlich C, Rein T, Zettlmeissl G: Complete cDNA sequence encoding the B subunit of human factor XIII. Nucleic Acids Res. 1990 May 11;18(9):2817-8. [PubMed:2339067]
  6. Schwartz ML, Pizzo SV, Hill RL, McKee PA: Human Factor XIII from plasma and platelets. Molecular weights, subunit structures, proteolytic activation, and cross-linking of fibrinogen and fibrin. J Biol Chem. 1973 Feb 25;248(4):1395-407. [PubMed:4405643]
  7. Koseki S, Souri M, Koga S, Yamakawa M, Shichishima T, Maruyama Y, Yanai F, Ichinose A: Truncated mutant B subunit for factor XIII causes its deficiency due to impaired intracellular transportation. Blood. 2001 May 1;97(9):2667-72. [PubMed:11313256]
  8. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  9. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  10. Muszbek L, Bereczky Z, Bagoly Z, Komaromi I, Katona E: Factor XIII: a coagulation factor with multiple plasmatic and cellular functions. Physiol Rev. 2011 Jul;91(3):931-72. doi: 10.1152/physrev.00016.2010. [PubMed:21742792]
  11. Hashiguchi T, Saito M, Morishita E, Matsuda T, Ichinose A: Two genetic defects in a patient with complete deficiency of the b-subunit for coagulation factor XIII. Blood. 1993 Jul 1;82(1):145-50. [PubMed:8324218]
  12. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209]
  13. Ivaskevicius V, Biswas A, Loreth R, Schroeder V, Ohlenforst S, Rott H, Krause M, Kohler HP, Scharrer I, Oldenburg J: Mutations affecting disulphide bonds contribute to a fairly common prevalence of F13B gene defects: results of a genetic study in 14 families with factor XIII B deficiency. Haemophilia. 2010 Jul 1;16(4):675-82. doi: 10.1111/j.1365-2516.2010.02207.x. Epub 2010 Mar 10. [PubMed:20331752]
  14. Thomas A, Biswas A, Ivaskevicius V, Oldenburg J: Structural and functional influences of coagulation factor XIII subunit B heterozygous missense mutants. Mol Genet Genomic Med. 2015 Jul;3(4):258-71. doi: 10.1002/mgg3.138. Epub 2015 Apr 10. [PubMed:26247044]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB09310CatridecacogapprovedyesDetails
DB11572Thrombin alfaapprovedyesactivatorDetails
DB11571Human ThrombinapprovedyesactivatorDetails
DB11300Thrombinapproved, investigationalyesactivatorDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails