DNA gyrase subunit A

Details

Name
DNA gyrase subunit A
Synonyms
  • 5.99.1.3
  • cafB
  • nalA
Gene Name
gyrA
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0021630|DNA gyrase subunit A
MSEQNTPQVREINISQEMRTSFLDYAMSVIVSRALPDVRDGLKPVHRRILYAMNDLGMTS
DKPYKKSARIVGEVIGKYHPHGDSAVYESMVRMAQDFNYRYMLVDGHGNFGSVDGDSAAA
MRYTEARMSKISMEILRDITKDTIDYQDNYDGSEREPVVMPSRFPNLLVNGAAGIAVGMA
TNIPPHQLGEIIDGVLAVSENPDITIPELMEVIPGPDFPTAGQILGRSGIRKAYESGRGS
ITIRAKAEIEQTSSGKERIIVTELPYQVNKAKLIEKIADLVRDKKIEGITDLRDESDRTG
MRIVIEIRRDANANVILNNLYKQTALQTSFGINLLALVDGQPKVLTLKQCLEHYLDHQKV
VIRRRTAYELRKAEARAHILEGLRVALDHLDAVISLIRNSQTAEIARTGLIEQFSLTEKQ
AQAILDMRLQRLTGLEREKIEEEYQSLVKLIAELKDILANEYKVLEIIREELTEIKERFN
DERRTEIVTSGLETIEDEDLIERENIVVTLTHNGYVKRLPASTYRSQKRGGKGVQGMGTN
EDDFVEHLISTSTHDTILFFSNKGKVYRAKGYEIPEYGRTAKGIPIINLLEVEKGEWINA
IIPVTEFNAELYLFFTTKHGVSKRTSLSQFANIRNNGLIALSLREDDELMGVRLTDGTKQ
IIIGTKNGLLIRFPETDVREMGRTAAGVKGITLTDDDVVVGMEILEEESHVLIVTEKGYG
KRTPAEEYRTQSRGGKGLKTAKITENNGQLVAVKATKGEEDLMIITASGVLIRMDINDIS
ITGRVTQGVRLIRMAEEEHVATVALVEKNEEDENEEEQEEV
Number of residues
821
Molecular Weight
92098.19
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / DNA binding / DNA topoisomerase type II (ATP-hydrolyzing) activity
Processes
chromosome segregation / DNA topological change / DNA unwinding involved in DNA replication
Components
chromosome / cytoplasm / DNA topoisomerase complex (ATP-hydrolyzing) / nucleoid
General Function
Dna topoisomerase type ii (atp-hydrolyzing) activity
Specific Function
DNA gyrase negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner and also catalyzes the interconversion of other topological isomers of double-stranded DNA rings, including catenanes and knotted rings.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0021631|DNA gyrase subunit A (gyrA)
ATGAGTGAACAAAACACACCACAAGTTCGTGAAATAAATATCAGTCAGGAAATGCGTACG
TCCTTCTTGGATTATGCAATGAGCGTTATCGTGTCCCGTGCTCTTCCGGATGTTCGTGAC
GGTTTAAAACCGGTTCATAGACGGATTTTGTATGCAATGAATGATTTAGGCATGACAAGT
GACAAGCCTTATAAAAAATCCGCGCGTATCGTTGGAGAAGTTATCGGGAAATACCACCCG
CACGGTGATTCAGCGGTATATGAATCCATGGTCAGAATGGCTCAGGATTTCAACTACCGT
TATATGCTCGTTGACGGTCACGGAAACTTCGGTTCTGTTGACGGAGACTCAGCGGCGGCC
ATGCGTTATACAGAAGCACGAATGTCTAAAATCTCAATGGAGATTCTTCGCGACATCACA
AAAGACACAATCGATTACCAGGATAACTATGACGGGTCAGAAAGAGAACCTGTCGTTATG
CCTTCAAGGTTCCCGAATCTGCTCGTGAACGGTGCTGCCGGCATTGCGGTAGGTATGGCA
ACAAACATTCCTCCGCACCAGCTGGGAGAAATCATTGACGGTGTACTTGCTGTTAGTGAG
AATCCGGACATTACAATTCCAGAGCTTATGGAAGTCATTCCAGGGCCTGATTTCCCGACC
GCGGGTCAAATCTTGGGACGCAGCGGTATCCGGAAAGCATACGAATCAGGCCGAGGCTCT
ATCACGATCCGGGCAAAAGCTGAGATCGAACAAACATCTTCGGGTAAAGAAAGAATTATC
GTTACAGAGTTACCTTACCAAGTAAATAAGGCGAAATTAATTGAGAAAATTGCTGATCTC
GTAAGGGACAAAAAGATAGAGGGTATCACAGATCTGCGTGATGAGTCAGATCGTACAGGT
ATGAGAATTGTCATTGAAATCAGACGCGATGCCAATGCGAATGTTATCTTAAACAATCTG
TACAAACAAACTGCTCTACAAACATCTTTTGGCATCAACCTGCTTGCGCTTGTTGATGGC
CAGCCGAAAGTTTTAACTCTTAAGCAATGCCTGGAGCATTACCTTGACCATCAAAAAGTT
GTCATTAGACGCCGTACTGCTTATGAATTGCGTAAAGCAGAAGCGAGAGCTCATATCTTG
GAAGGATTGAGAGTTGCACTGGATCATCTCGATGCAGTTATCTCCCTTATCCGTAATTCT
CAAACGGCTGAAATTGCGAGAACAGGTTTAATTGAACAATTCTCACTGACAGAGAAGCAA
GCACAAGCGATCCTTGACATGAGGCTCCAGCGTTTAACGGGACTGGAACGTGAAAAGATC
GAAGAAGAATACCAGTCTCTTGTTAAATTAATTGCAGAGCTAAAAGACATCTTGGCAAAT
GAATATAAAGTGCTTGAGATCATTCGTGAAGAACTCACGGAAATCAAAGAGCGTTTTAAC
GATGAAAGACGTACTGAGATCGTCACTTCTGGACTGGAGACAATTGAAGATGAAGATCTC
ATCGAGAGAGAAAATATCGTAGTTACTCTGACGCACAACGGATACGTCAAACGTCTTCCT
GCATCAACTTACCGCAGTCAAAAACGGGGCGGAAAAGGTGTACAAGGTATGGGAACAAAC
GAAGATGATTTCGTTGAACATTTGATCTCTACGTCAACTCATGACACGATTCTCTTCTTC
TCGAACAAGGGGAAAGTGTATCGTGCAAAAGGGTATGAAATCCCTGAATACGGCAGAACG
GCAAAAGGAATCCCGATTATTAACCTGCTGGAGGTAGAAAAGGGTGAGTGGATCAACGCG
ATTATTCCAGTCACGGAATTCAATGCGGAGCTTTACCTCTTCTTCACTACAAAGCATGGG
GTTTCAAAACGAACATCGCTATCTCAATTCGCTAATATCCGCAACAATGGTCTAATTGCT
CTGAGTCTTCGTGAAGATGATGAACTGATGGGTGTACGTCTGACTGACGGCACAAAACAA
ATCATCATTGGAACGAAAAACGGTTTACTGATTCGTTTCCCTGAAACAGATGTCCGAGAG
ATGGGAAGAACTGCGGCGGGCGTAAAAGGCATCACCCTGACGGATGACGACGTTGTTGTC
GGCATGGAGATTTTAGAGGAAGAATCACACGTCCTTATCGTAACTGAAAAAGGGTACGGA
AAACGAACTCCTGCTGAAGAGTACAGAACCCAAAGCCGGGGCGGAAAAGGACTCAAAACA
GCGAAAATCACCGAGAACAACGGCCAACTAGTAGCAGTGAAAGCTACTAAAGGTGAAGAG
GATCTAATGATTATTACAGCTAGCGGCGTACTCATCAGAATGGACATCAATGATATCTCC
ATCACCGGACGTGTCACTCAAGGTGTGCGTCTCATCAGAATGGCAGAAGAAGAGCATGTT
GCTACAGTAGCTTTAGTTGAGAAAAACGAAGAAGATGAGAATGAAGAAGAACAAGAAGAA
GTGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP05653
UniProtKB Entry NameGYRA_BACSU
General References
  1. Moriya S, Ogasawara N, Yoshikawa H: Structure and function of the region of the replication origin of the Bacillus subtilis chromosome. III. Nucleotide sequence of some 10,000 base pairs in the origin region. Nucleic Acids Res. 1985 Apr 11;13(7):2251-65. [PubMed:2987847]
  2. Ogasawara N, Nakai S, Yoshikawa H: Systematic sequencing of the 180 kilobase region of the Bacillus subtilis chromosome containing the replication origin. DNA Res. 1994;1(1):1-14. [PubMed:7584024]
  3. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00537Ciprofloxacinapproved, investigationalunknownDetails