5-hydroxytryptamine receptor 2C

Details

Name
5-hydroxytryptamine receptor 2C
Synonyms
  • 5-HT-1C
  • 5-HT-2C
  • 5-HT1C
  • 5-hydroxytryptamine receptor 1C
  • 5ht1c
  • Htr1c
  • Serotonin receptor 2C
Gene Name
Htr2c
Organism
Rat
Amino acid sequence
>lcl|BSEQ0021418|5-hydroxytryptamine receptor 2C
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Number of residues
460
Molecular Weight
51916.005
Theoretical pI
Not Available
GO Classification
Functions
Gq/11-coupled serotonin receptor activity / serotonin receptor activity
Processes
behavioral fear response / behavioral response to nicotine / feeding behavior / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / inositol phosphate-mediated signaling / locomotory behavior / negative regulation of dopamine metabolic process / negative regulation of locomotion / organ regeneration / phospholipase C-activating serotonin receptor signaling pathway / phospholipase D-activating G-protein coupled receptor signaling pathway / positive regulation of acetylcholine secretion, neurotransmission / positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway / positive regulation of gamma-aminobutyric acid secretion / positive regulation of vasoconstriction / regulation of appetite / regulation of corticotropin-releasing hormone secretion / regulation of neurological system process / regulation of sensory perception of pain / response to drug
Components
cell surface / cytosol / external side of plasma membrane / integral component of plasma membrane / intracellular
General Function
Serotonin receptor activity
Specific Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca(2+) ions from intracellular stores. Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelacortin neurons and the release of CRH that then regulates the release of corticosterone. Plays a role in the regulation of appetite and feeding behavior, responses to anxiogenic stimuli and stress. Plays a role in insulin sensitivity and glucose homeostasis.
Pfam Domain Function
Transmembrane Regions
54-79 91-111 129-151 172-194 215-236 314-335 351-373
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021419|5-hydroxytryptamine receptor 2C (Htr2c)
ATGGTGAACCTTGGCAACGCGGTGCGCTCGCTCCTGATGCACCTAATCGGCCTATTGGTT
TGGCAATTCGATATTTCCATAAGTCCAGTAGCAGCTATAGTAACTGACACTTTTAATTCC
TCCGATGGTGGACGCTTGTTTCAATTCCCGGACGGGGTACAAAACTGGCCAGCACTTTCA
ATCGTCGTGATTATAATCATGACAATAGGGGGCAACATTCTTGTTATCATGGCAGTAAGC
ATGGAGAAGAAACTGCACAATGCAACCAATTACTTCTTAATGTCCCTAGCCATTGCTGAT
ATGCTGGTGGGACTACTTGTCATGCCCCTGTCCCTGCTTGCTATTCTTTATGATTATGTC
TGGCCTTTACCTAGATATTTGTGCCCCGTCTGGATTTCACTAGATGTGCTATTTTCAACT
GCGTCCATCATGCACCTCTGCGCCATATCGCTGGACCGGTATGTAGCAATACGTAATCCT
ATTGAGCATAGCCGGTTCAATTCGCGGACTAAGGCCATCATGAAGATTGCCATCGTTTGG
GCAATATCAATAGGAGTTTCAGTTCCTATCCCTGTGATTGGACTGAGGGACGAAAGCAAA
GTGTTCGTGAATAACACCACGTGCGTGCTCAATGACCCCAACTTCGTTCTCATCGGGTCC
TTCGTGGCATTCTTCATCCCGTTGACGATTATGGTGATCACCTACTTCTTAACGATCTAC
GTCCTGCGCCGTCAAACTCTGATGTTACTTCGAGGTCACACCGAGGAGGAACTGGCTAAT
ATGAGCCTGAACTTTCTGAACTGCTGCTGCAAGAAGAATGGTGGTGAGGAAGAGAACGCT
CCGAACCCTAATCCAGATCAGAAACCACGTCGAAAGAAGAAAGAAAAGCGTCCCAGAGGC
ACCATGCAAGCTATCAACAACGAAAAGAAAGCTTCCAAAGTCCTTGGCATTGTATTCTTT
GTGTTTCTGATCATGTGGTGCCCGTTTTTCATCACCAATATCCTGTCGGTTCTTTGTGGG
AAGGCCTGTAACCAAAAGCTAATGGAGAAGCTTCTCAATGTGTTTGTGTGGATTGGCTAT
GTGTGTTCAGGCATCAATCCTCTGGTGTACACTCTCTTTAATAAAATTTACCGAAGGGCT
TTCTCTAAATATTTGCGCTGCGATTATAAGCCAGACAAAAAGCCTCCTGTTCGACAGATT
CCTAGGGTTGCTGCCACTGCTTTGTCTGGGAGGGAGCTCAATGTTAACATTTATCGGCAT
ACCAATGAACGTGTGGCTAGGAAAGCTAATGACCCTGAGCCTGGCATAGAGATGCAGGTG
GAGAACTTAGAGCTGCCAGTCAACCCCTCTAATGTGGTCAGCGAGAGGATTAGTAGTGTG
TAA
Chromosome Location
X
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP08909
UniProtKB Entry Name5HT2C_RAT
General References
  1. Julius D, MacDermott AB, Axel R, Jessell TM: Molecular characterization of a functional cDNA encoding the serotonin 1c receptor. Science. 1988 Jul 29;241(4865):558-64. [PubMed:3399891]
  2. Parker LL, Backstrom JR, Sanders-Bush E, Shieh BH: Agonist-induced phosphorylation of the serotonin 5-HT2C receptor regulates its interaction with multiple PDZ protein 1. J Biol Chem. 2003 Jun 13;278(24):21576-83. Epub 2003 Apr 7. [PubMed:12682077]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00726TrimipramineapprovedunknownbinderDetails
DB00321AmitriptylineapprovedunknownantagonistDetails
DB00656Trazodoneapproved, investigationalunknownantagonistpartial agonistDetails