Release factor glutamine methyltransferase

Details

Name
Release factor glutamine methyltransferase
Synonyms
  • 2.1.1.297
  • hemK
  • M.EcoKHemKP
  • N5-glutamine methyltransferase PrmC
  • Protein release factor methylation C
  • Protein-(glutamine-N5) MTase PrmC
  • Protein-glutamine N-methyltransferase PrmC
  • RF MTase
Gene Name
prmC
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0004049|Release factor glutamine methyltransferase
MEYQHWLREAISQLQASESPRRDAEILLEHVTGRGRTFILAFGETQLTDEQCQQLDALLT
RRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQALARLPEQPCRILDLGTGT
GAIALALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAGQQFAMI
VSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGW
QQGEAVRQAFILAGYHDVETCRDYGDNERVTLGRYYQ
Number of residues
277
Molecular Weight
30974.67
Theoretical pI
4.6
GO Classification
Functions
nucleic acid binding / protein methyltransferase activity / protein-glutamine N-methyltransferase activity / S-adenosylmethionine-dependent methyltransferase activity
Processes
peptidyl-glutamine methylation / protein methylation / regulation of gene expression / translational termination
General Function
S-adenosylmethionine-dependent methyltransferase activity
Specific Function
Methylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif, i.e. on 'Gln-235' in RF1 and on 'Gln-252' in RF2.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0021314|Release factor glutamine methyltransferase (prmC)
ATGGAATATCAACACTGGTTACGTGAAGCAATAAGCCAACTTCAGGCGAGCGAAAGCCCG
CGGCGTGATGCTGAAATCCTGCTGGAGCATGTTACCGGCAGAGGGCGTACTTTTATTCTC
GCCTTTGGTGAAACGCAGCTGACTGACGAACAATGTCAGCAACTTGATGCGCTACTGACA
CGTCGTCGCGATGGTGAACCCATTGCTCATTTAACCGGGGTGCGAGAATTCTGGTCGTTG
CCGTTATTTGTTTCGCCAGCGACCTTAATTCCGCGCCCGGATACGGAGTGTCTGGTGGAG
CAGGCACTGGCGCGGTTGCCTGAACAACCTTGCCGTATTCTCGATCTCGGGACGGGTACC
GGGGCGATTGCGCTTGCGCTGGCTAGCGAGCGCCCGGACTGCGAAATTATCGCTGTAGAT
CGTATGCCTGATGCTGTCTCCCTGGCACAACGTAATGCCCAGCATCTGGCGATCAAAAAT
ATCCACATTCTGCAAAGCGACTGGTTTAGCGCGCTAGCCGGGCAGCAGTTTGCGATGATT
GTCAGCAATCCGCCGTATATTGACGAGCAGGACCCTCATCTTCAACAAGGCGATGTCCGC
TTTGAGCCGCTCACTGCGCTGGTTGCGGCAGACAGTGGAATGGCAGACATCGTGCATATC
ATCGAACAGTCGCGTAACGCGCTGGTATCCGGCGGCTTTCTGCTTCTGGAACATGGCTGG
CAGCAGGGCGAAGCGGTGCGACAAGCATTTATCCTCGCGGGGTATCATGACGTCGAAACC
TGCCGTGACTATGGTGATAACGAGCGCGTAACGCTCGGCCGCTATTATCAATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0ACC1
UniProtKB Entry NamePRMC_ECOLI
GenBank Gene IDD28567
General References
  1. Nakayashiki T, Nishimura K, Inokuchi H: Cloning and sequencing of a previously unidentified gene that is involved in the biosynthesis of heme in Escherichia coli. Gene. 1995 Feb 3;153(1):67-70. [PubMed:7883187]
  2. Strohmaier H, Remler P, Renner W, Hogenauer G: Expression of genes kdsA and kdsB involved in 3-deoxy-D-manno-octulosonic acid metabolism and biosynthesis of enterobacterial lipopolysaccharide is growth phase regulated primarily at the transcriptional level in Escherichia coli K-12. J Bacteriol. 1995 Aug;177(15):4488-500. [PubMed:7543480]
  3. Nakahigashi K, Kubo N, Narita S, Shimaoka T, Goto S, Oshima T, Mori H, Maeda M, Wada C, Inokuchi H: HemK, a class of protein methyl transferase with similarity to DNA methyl transferases, methylates polypeptide chain release factors, and hemK knockout induces defects in translational termination. Proc Natl Acad Sci U S A. 2002 Feb 5;99(3):1473-8. Epub 2002 Jan 22. [PubMed:11805295]
  4. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.: A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. DNA Res. 1996 Jun 30;3(3):137-55. [PubMed:8905232]
  5. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  6. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  7. Heurgue-Hamard V, Champ S, Engstrom A, Ehrenberg M, Buckingham RH: The hemK gene in Escherichia coli encodes the N(5)-glutamine methyltransferase that modifies peptide release factors. EMBO J. 2002 Feb 15;21(4):769-78. [PubMed:11847124]
  8. Yang Z, Shipman L, Zhang M, Anton BP, Roberts RJ, Cheng X: Structural characterization and comparative phylogenetic analysis of Escherichia coli HemK, a protein (N5)-glutamine methyltransferase. J Mol Biol. 2004 Jul 16;340(4):695-706. [PubMed:15223314]
  9. Graille M, Heurgue-Hamard V, Champ S, Mora L, Scrima N, Ulryck N, van Tilbeurgh H, Buckingham RH: Molecular basis for bacterial class I release factor methylation by PrmC. Mol Cell. 2005 Dec 22;20(6):917-27. [PubMed:16364916]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails