Inactive dihydropteroate synthase 2

Details

Name
Inactive dihydropteroate synthase 2
Synonyms
  • DHPS 2
  • Dihydropteroate pyrophosphorylase 2
Gene Name
folP2
Organism
Mycobacterium leprae (strain TN)
Amino acid sequence
>lcl|BSEQ0011514|Inactive dihydropteroate synthase 2
MQSMLCGRPVAADRQLIMAIVNRTPDSFYDRGATFSDEAARAAAHRAVAEGADVIDVGGV
KAGPGQGVDVDTEIARLVPFIEWLRSAYTDLLISVDTWRAEVARLACTAGADLINDSWGG
ADPAMHEVAAELGAGLVCSHTGGALPRTRPFRVSYGTTTRGVVDDVIRQVTAAAERAVAA
GVTRDSVLVDPTHDFGKNTFHGLLLLRHVDELVKTGWPVLMSLSNKDFVGETLGVGLTER
LEGTLAATALAAAAGVRMFRVHEVVATRRVLEMVASIQGTRPPTRTVRGLA
Number of residues
291
Molecular Weight
30850.89
Theoretical pI
6.4
GO Classification
Functions
dihydropteroate synthase activity
Processes
folic acid-containing compound biosynthetic process
General Function
Has very low affinity for the DHPS substrate 6-hydroxymethyl-7,8-dihydropterin-pyrophosphate, but can bind the inhibitor dapsone. Seems to lack dihydropteroate synthase activity, and does probably not function in folate metabolism (By similarity).
Specific Function
Dihydropteroate synthase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011515|Inactive dihydropteroate synthase 2 (folP2)
GTGCAGTCAATGCTGTGCGGCCGGCCGGTCGCAGCGGATCGCCAACTGATCATGGCGATC
GTCAACCGTACCCCGGATTCGTTCTATGACCGGGGCGCGACCTTCAGTGACGAGGCTGCT
CGTGCTGCAGCGCACCGGGCCGTTGCGGAGGGCGCCGATGTCATCGATGTCGGCGGCGTT
AAAGCAGGGCCTGGTCAGGGCGTTGACGTAGACACCGAGATCGCCCGGTTGGTTCCGTTC
ATCGAATGGCTACGCAGCGCCTATACAGACCTGCTGATCAGCGTAGACACCTGGCGAGCA
GAGGTAGCAAGACTGGCTTGCACTGCGGGCGCAGACCTGATCAACGACAGCTGGGGTGGA
GCCGACCCGGCCATGCATGAGGTCGCCGCTGAGCTTGGCGCGGGCCTGGTGTGTTCGCAC
ACCGGTGGCGCGCTGCCCCGCACGCGTCCCTTTCGGGTGAGTTACGGTACGACGACCCGC
GGTGTGGTGGACGATGTGATTCGCCAGGTCACTGCAGCTGCCGAGCGCGCGGTCGCGGCC
GGGGTAACCCGCGATTCGGTGTTGGTCGACCCGACCCACGATTTCGGCAAGAACACTTTC
CACGGGCTGCTGCTGTTGCGTCATGTAGACGAACTTGTTAAGACCGGGTGGCCCGTGCTC
ATGTCGTTGAGCAATAAGGACTTCGTCGGGGAGACTCTGGGCGTGGGTTTGACGGAACGG
CTAGAGGGTACGTTGGCGGCCACTGCGTTGGCGGCGGCAGCTGGCGTCCGCATGTTTCGG
GTGCACGAGGTCGTAGCGACCAGGCGGGTTCTGGAGATGGTGGCTTCGATCCAGGGGACG
CGTCCCCCAACGCGCACGGTGAGGGGACTCGCATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0C0X2
UniProtKB Entry NameDHPS2_MYCLE
GenBank Protein ID699152
GenBank Gene IDU15180
General References
  1. Cole ST, Eiglmeier K, Parkhill J, James KD, Thomson NR, Wheeler PR, Honore N, Garnier T, Churcher C, Harris D, Mungall K, Basham D, Brown D, Chillingworth T, Connor R, Davies RM, Devlin K, Duthoy S, Feltwell T, Fraser A, Hamlin N, Holroyd S, Hornsby T, Jagels K, Lacroix C, Maclean J, Moule S, Murphy L, Oliver K, Quail MA, Rajandream MA, Rutherford KM, Rutter S, Seeger K, Simon S, Simmonds M, Skelton J, Squares R, Squares S, Stevens K, Taylor K, Whitehead S, Woodward JR, Barrell BG: Massive gene decay in the leprosy bacillus. Nature. 2001 Feb 22;409(6823):1007-11. [PubMed:11234002]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00250Dapsoneapproved, investigationalyesinhibitorDetails