Phenylethanolamine N-methyltransferase
Details
- Name
- Phenylethanolamine N-methyltransferase
- Synonyms
- 2.1.1.28
- Noradrenaline N-methyltransferase
- PNMTase
- Gene Name
- PNMT
- Organism
- Bovine
- Amino acid sequence
>lcl|BSEQ0014025|Phenylethanolamine N-methyltransferase MSGTDRSQAAGAVPDSDPGLAAVSSAYQRFEPRAYLRNNYAPPRGDLSCPDGVGPWKLRC LAQTFATGEVSGRTLIDIGSGPTIYQLLSACAHFEDITMTDFLEVNRQELRLWLREEPGA FDWSVYSQHVCLIEGKGESWQEKECQLRARVKRILPIDVHRPQPLGAGGLAPLPADALVS AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLAVVPVREEEVR EALVRTATRCGICARTPMPAHLQTGVDDVKGIFFTRAQKKVGV
- Number of residues
- 283
- Molecular Weight
- 30917.99
- Theoretical pI
- Not Available
- GO Classification
- Functionsphenylethanolamine N-methyltransferase activityProcessesepinephrine biosynthetic process
- General Function
- Phenylethanolamine n-methyltransferase activity
- Specific Function
- Converts noradrenaline to adrenaline.
- Pfam Domain Function
- NNMT_PNMT_TEMT (PF01234)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P10938 UniProtKB Entry Name PNMT_BOVIN - General References
- Baetge EE, Suh YH, Joh TH: Complete nucleotide and deduced amino acid sequence of bovine phenylethanolamine N-methyltransferase: partial amino acid homology with rat tyrosine hydroxylase. Proc Natl Acad Sci U S A. 1986 Aug;83(15):5454-8. [Article]
- Batter DK, D'Mello SR, Turzai LM, Hughes HB 3rd, Gioio AE, Kaplan BB: The complete nucleotide sequence and structure of the gene encoding bovine phenylethanolamine N-methyltransferase. J Neurosci Res. 1988 Mar;19(3):367-76. [Article]
- Weisberg EP, Batter DK, Brown WE, Kaplan BB: Purification and partial amino acid sequence of bovine adrenal phenylethanolamine N-methyltransferase: a comparison of nucleic acid and protein sequence data. J Neurosci Res. 1988 Mar;19(3):377-82. [Article]
- Wong DL, Yoo YS, Lau K, Schilling JW: Primary structure of bovine adrenal phenylethanolamine N-methyltransferase. Neuropsychopharmacology. 1990 Jun;3(3):175-80. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details