Modification methylase PvuII

Details

Name
Modification methylase PvuII
Synonyms
  • 2.1.1.113
  • M.PvuII
  • N-4 cytosine-specific methyltransferase PvuII
Gene Name
pvuIIM
Organism
Proteus hauseri
Amino acid sequence
>lcl|BSEQ0016813|Modification methylase PvuII
MMTLNLQTMSSNDMLNFGKKPAYTTSNGSMYIGDSLELLESFPDESISLVMTSPPFALQR
KKEYGNLEQHEYVDWFLSFAKVVNKKLKPDGSFVVDFGGAYMKGVPARSIYNFRVLIRMI
DEVGFFLAEDFYWFNPSKLPSPIEWVNKRKIRVKDAVNTVWWFSKTEWPKSDITKVLAPY
SDRMKKLIEDPDKFYTPKTRPSGHDIGKSFSKDNGGSIPPNLLQISNSESNGQYLANCKL
MGIKAHPARFPAKLPEFFIRMLTEPDDLVVDIFGGSNTTGLVAERESRKWISFEMKPEYV
AASAFRFLDNNISEEKITDIYNRILNGESLDLNSII
Number of residues
336
Molecular Weight
38364.585
Theoretical pI
7.58
GO Classification
Functions
DNA binding / N-methyltransferase activity / site-specific DNA-methyltransferase (cytosine-N4-specific) activity
Processes
DNA restriction-modification system
General Function
Site-specific dna-methyltransferase (cytosine-n4-specific) activity
Specific Function
This methylase recognizes the double-stranded sequence CAGCTG, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the PvuII endonuclease.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0004946|1011 bp
ATGATGACTTTGAATCTACAGACTATGAGTAGCAATGATATGTTGAATTTTGGAAAAAAA
CCTGCCTACACAACTAGTAATGGGTCTATGTATATAGGTGACTCATTGGAGCTATTAGAA
TCATTCCCAGAAGAAAGTATTAGTCTGGTTATGACTAGTCCTCCCTTCGCATTACAACGA
AAAAAAGAATACGGAAACTTAGAACAGCATGAGTATGTGGATTGGTTTTTGTCATTTGCT
AAAGTGGTTAATAAGAAACTAAAACCGGATGGAAGTTTTGTTGTAGATTTTGGTGGGGCG
TACATGAAAGGCGTTCCAGCAAGAAGTATCTATAACTTTAGAGTTTTGATCAGAATGATA
GACGAAGTGGGTTTTTTTCTTGCTGAAGATTTTTATTGGTTTAACCCATCAAAATTACCA
AGCCCTATAGAATGGGTTAATAAGAGAAAAATAAGAGTTAAAGATGCAGTGAATACAGTA
TGGTGGTTCTCTAAAACAGAGTGGCCTAAGTCTGATATAACGAAAGTTCTAGCTCCATAT
AGCGATAGAATGAAAAAGTTAATTGAAGACCCAGACAAATTCTATACACCAAAAACTAGA
CCATCTGGGCATGATATAGGGAAGTCGTTCTCTAAAGACAATGGAGGTTCAATTCCTCCT
AATTTATTACAAATATCAAACTCAGAATCAAATGGTCAATATTTAGCCAATTGTAAGTTG
ATGGGTATTAAAGCGCATCCCGCTAGATTCCCTGCTAAGTTACCCGAGTTTTTTATTAGA
ATGTTAACTGAGCCAGATGATCTTGTTGTTGATATTTTTGGCGGCTCTAATACTACTGGT
CTAGTCGCAGAAAGAGAATCTCGTAAATGGATCTCGTTTGAGATGAAACCTGAATATGTT
GCGGCATCGGCGTTTCGTTTTTTAGACAATAATATAAGTGAAGAAAAAATAACTGATATT
TATAATCGAATCCTTAATGGTGAGTCTTTGGATTTAAACTCTATTATCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP11409
UniProtKB Entry NameMTP2_PROHU
GenBank Gene IDX13778
General References
  1. Tao T, Walter J, Brennan KJ, Cotterman MM, Blumenthal RM: Sequence, internal homology and high-level expression of the gene for a DNA-(cytosine N4)-methyltransferase, M.Pvu II. Nucleic Acids Res. 1989 Jun 12;17(11):4161-75. [PubMed:2662138]
  2. Adams GM, Blumenthal RM: Gene pvuIIW: a possible modulator of PvuII endonuclease subunit association. Gene. 1995 May 19;157(1-2):193-9. [PubMed:7607491]
  3. Gong W, O'Gara M, Blumenthal RM, Cheng X: Structure of pvu II DNA-(cytosine N4) methyltransferase, an example of domain permutation and protein fold assignment. Nucleic Acids Res. 1997 Jul 15;25(14):2702-15. [PubMed:9207015]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails