Glutamine--fructose-6-phosphate aminotransferase [isomerizing]

Details

Name
Glutamine--fructose-6-phosphate aminotransferase [isomerizing]
Synonyms
  • 2.6.1.16
  • D-fructose-6-phosphate amidotransferase
  • GFAT
  • Glucosamine-6-phosphate synthase
  • Hexosephosphate aminotransferase
  • L-glutamine--D-fructose-6-phosphate amidotransferase
Gene Name
glmS
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0016420|Glutamine--fructose-6-phosphate aminotransferase [isomerizing]
MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAE
EHPLHGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFV
SETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLV
IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDKTGAEVKRQDIESNLQ
YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILA
CGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGL
RLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKL
SRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIA
LEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRAR
GGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPR
NLAKSVTVE
Number of residues
609
Molecular Weight
66893.7
Theoretical pI
5.74
GO Classification
Functions
carbohydrate binding / glutamine-fructose-6-phosphate transaminase (isomerizing) activity
Processes
carbohydrate metabolic process / glutamine metabolic process / UDP-N-acetylglucosamine biosynthetic process
Components
cytosol
General Function
Glutamine-fructose-6-phosphate transaminase (isomerizing) activity
Specific Function
Catalyzes the first step in hexosamine metabolism, converting fructose-6P into glucosamine-6P using glutamine as a nitrogen source.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0016421|Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS)
ATGTGTGGAATTGTTGGCGCGATCGCGCAACGTGATGTAGCAGAAATCCTTCTTGAAGGT
TTACGTCGTCTGGAATACCGCGGATATGACTCTGCCGGTCTGGCCGTTGTTGATGCAGAA
GGTCATATGACCCGCCTGCGTCGCCTCGGTAAAGTCCAGATGCTGGCACAGGCAGCGGAA
GAACATCCTCTGCATGGCGGCACTGGTATTGCTCACACTCGCTGGGCGACCCACGGTGAA
CCTTCAGAAGTGAATGCGCATCCGCATGTTTCTGAACACATTGTGGTGGTGCATAACGGC
ATCATCGAAAACCATGAACCGCTGCGTGAAGAGCTAAAAGCGCGTGGCTATACCTTCGTT
TCTGAAACCGACACCGAAGTGATTGCCCATCTGGTGAACTGGGAGCTGAAACAAGGCGGG
ACTCTGCGTGAGGCCGTTCTGCGTGCTATCCCGCAGCTGCGTGGTGCGTACGGTACAGTG
ATCATGGACTCCCGTCACCCGGATACCCTGCTGGCGGCACGTTCTGGTAGTCCGCTGGTG
ATTGGCCTGGGGATGGGCGAAAACTTTATCGCTTCTGACCAGCTGGCGCTGTTGCCGGTG
ACCCGTCGCTTTATCTTCCTTGAAGAGGGCGATATTGCGGAAATCACTCGCCGTTCGGTA
AACATCTTCGATAAAACTGGCGCGGAAGTAAAACGTCAGGATATCGAATCCAATCTGCAA
TATGACGCGGGCGATAAAGGCATTTACCGTCACTACATGCAGAAAGAGATCTACGAACAG
CCGAACGCGATCAAAAACACCCTTACCGGACGCATCAGCCACGGTCAGGTTGATTTAAGC
GAGCTGGGACCGAACGCCGACGAACTGCTGTCGAAGGTTGAGCATATTCAGATCCTCGCC
TGTGGTACTTCTTATAACTCCGGTATGGTTTCCCGCTACTGGTTTGAATCGCTAGCAGGT
ATTCCGTGCGACGTCGAAATCGCCTCTGAATTCCGCTATCGCAAATCTGCCGTGCGTCGT
AACAGCCTGATGATCACCTTGTCACAGTCTGGCGAAACCGCGGATACCCTGGCTGGCCTG
CGTCTGTCGAAAGAGCTGGGTTACCTTGGTTCACTGGCAATCTGTAACGTTCCGGGTTCT
TCTCTGGTGCGCGAATCCGATCTGGCGCTAATGACCAACGCGGGTACAGAAATCGGCGTG
GCATCCACTAAAGCATTCACCACTCAGTTAACTGTGCTGTTGATGCTGGTGGCGAAGCTG
TCTCGCCTGAAAGGTCTGGATGCCTCCATTGAACATGACATCGTGCATGGTCTGCAGGCG
CTGCCGAGCCGTATTGAGCAGATGCTGTCTCAGGACAAACGCATTGAAGCGCTGGCAGAA
GATTTCTCTGACAAACATCACGCGCTGTTCCTGGGCCGTGGCGATCAGTACCCAATCGCG
CTGGAAGGCGCATTGAAGTTGAAAGAGATCTCTTACATTCACGCTGAAGCCTACGCTGCT
GGCGAACTGAAACACGGTCCGCTGGCGCTAATTGATGCCGATATGCCGGTTATTGTTGTT
GCACCGAACAACGAATTGCTGGAAAAACTGAAATCCAACATTGAAGAAGTTCGCGCGCGT
GGCGGTCAGTTGTATGTCTTCGCCGATCAGGATGCGGGTTTTGTAAGTAGCGATAACATG
CACATCATCGAGATGCCGCATGTGGAAGAGGTGATTGCACCGATCTTCTACACCGTTCCG
CTGCAGCTGCTGGCTTACCATGTCGCGCTGATCAAAGGCACCGACGTTGACCAGCCGCGT
AACCTGGCAAAATCGGTTACGGTTGAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP17169
UniProtKB Entry NameGLMS_ECOLI
GenBank Protein ID43268
GenBank Gene IDX01631
General References
  1. Walker JE, Gay NJ, Saraste M, Eberle AN: DNA sequence around the Escherichia coli unc operon. Completion of the sequence of a 17 kilobase segment containing asnA, oriC, unc, glmS and phoS. Biochem J. 1984 Dec 15;224(3):799-815. [PubMed:6395859]
  2. Burland V, Plunkett G 3rd, Daniels DL, Blattner FR: DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication. Genomics. 1993 Jun;16(3):551-61. [PubMed:7686882]
  3. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  4. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  5. Golinelli-Pimpaneau B, Badet B: Possible involvement of Lys603 from Escherichia coli glucosamine-6-phosphate synthase in the binding of its substrate fructose 6-phosphate. Eur J Biochem. 1991 Oct 1;201(1):175-82. [PubMed:1915361]
  6. Lichtenstein C, Brenner S: Unique insertion site of Tn7 in the E. coli chromosome. Nature. 1982 Jun 17;297(5867):601-3. [PubMed:6283361]
  7. Gay NJ, Tybulewicz VL, Walker JE: Insertion of transposon Tn7 into the Escherichia coli glmS transcriptional terminator. Biochem J. 1986 Feb 15;234(1):111-7. [PubMed:3010949]
  8. McKown RL, Orle KA, Chen T, Craig NL: Sequence requirements of Escherichia coli attTn7, a specific site of transposon Tn7 insertion. J Bacteriol. 1988 Jan;170(1):352-8. [PubMed:2826397]
  9. Dutka-Malen S, Mazodier P, Badet B: Molecular cloning and overexpression of the glucosamine synthetase gene from Escherichia coli. Biochimie. 1988 Feb;70(2):287-90. [PubMed:3134953]
  10. Reichenbach B, Maes A, Kalamorz F, Hajnsdorf E, Gorke B: The small RNA GlmY acts upstream of the sRNA GlmZ in the activation of glmS expression and is subject to regulation by polyadenylation in Escherichia coli. Nucleic Acids Res. 2008 May;36(8):2570-80. doi: 10.1093/nar/gkn091. Epub 2008 Mar 11. [PubMed:18334534]
  11. Urban JH, Vogel J: Two seemingly homologous noncoding RNAs act hierarchically to activate glmS mRNA translation. PLoS Biol. 2008 Mar 18;6(3):e64. doi: 10.1371/journal.pbio.0060064. [PubMed:18351803]
  12. Gopel Y, Papenfort K, Reichenbach B, Vogel J, Gorke B: Targeted decay of a regulatory small RNA by an adaptor protein for RNase E and counteraction by an anti-adaptor RNA. Genes Dev. 2013 Mar 1;27(5):552-64. doi: 10.1101/gad.210112.112. [PubMed:23475961]
  13. Isupov MN, Obmolova G, Butterworth S, Badet-Denisot MA, Badet B, Polikarpov I, Littlechild JA, Teplyakov A: Substrate binding is required for assembly of the active conformation of the catalytic site in Ntn amidotransferases: evidence from the 1.8 A crystal structure of the glutaminase domain of glucosamine 6-phosphate synthase. Structure. 1996 Jul 15;4(7):801-10. [PubMed:8805567]
  14. Teplyakov A, Obmolova G, Badet-Denisot MA, Badet B, Polikarpov I: Involvement of the C terminus in intramolecular nitrogen channeling in glucosamine 6-phosphate synthase: evidence from a 1.6 A crystal structure of the isomerase domain. Structure. 1998 Aug 15;6(8):1047-55. [PubMed:9739095]
  15. Teplyakov A, Obmolova G, Badet-Denisot MA, Badet B: The mechanism of sugar phosphate isomerization by glucosamine 6-phosphate synthase. Protein Sci. 1999 Mar;8(3):596-602. [PubMed:10091662]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02007alpha-D-glucose 6-phosphateexperimentalunknownDetails
DB024452-Deoxy-2-Amino Glucitol-6-PhosphateexperimentalunknownDetails
DB02446Glutamine hydroxamateexperimentalunknownDetails
DB02657Glucosamine 6-PhosphateexperimentalunknownDetails
DB03581Glucose-6-PhosphateexperimentalunknownDetails
DB038142-(N-morpholino)ethanesulfonic acidexperimentalunknownDetails