Siroheme synthase

Details

Name
Siroheme synthase
Synonyms
  • 2.1.1.107
  • Urogen III methylase
Gene Name
cysG
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Amino acid sequence
>lcl|BSEQ0019295|Siroheme synthase
MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLEAGARLTVNALTFIPQFTVWANEGMLTL
VEGPFDETLLDSCWLAIAATDDDTVNQRVSDAAESRRIFCNVVDAPKAASFIMPSIIDRS
PLMVAVSSGGTSPVLARLLREKLESLLPQHLGQVARYAGQLRARVKKQFATMGERRRFWE
KFFVNDRLAQSLANADEKAVNATTERLFSEPLDHRGEVVLVGAGPGDAGLLTLKGLQQIQ
QADIVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLK
GGDPFIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHL
KTGGELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVH
GVLTQLGELAQQVESPALIIVGRVVALRDKLNWFSNH
Number of residues
457
Molecular Weight
50146.22
Theoretical pI
6.79
GO Classification
Functions
NAD binding / precorrin-2 dehydrogenase activity / sirohydrochlorin ferrochelatase activity / uroporphyrin-III C-methyltransferase activity
Processes
cobalamin biosynthetic process / siroheme biosynthetic process
General Function
Uroporphyrin-iii c-methyltransferase activity
Specific Function
Multifunctional enzyme that catalyzes the SAM-dependent methylations of uroporphyrinogen III at position C-2 and C-7 to form precorrin-2 via precorrin-1. Then it catalyzes the NAD-dependent ring dehydrogenation of precorrin-2 to yield sirohydrochlorin. Finally, it catalyzes the ferrochelation of sirohydrochlorin to yield siroheme.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0019296|Siroheme synthase (cysG)
GTGGACCATTTGCCTATATTTTGTCAATTACGCGACCGCGACTGTCTGATCGTCGGCGGT
GGCGATGTCGCAGAACGCAAAGCACGGTTACTGCTGGAAGCAGGCGCACGTTTAACGGTC
AATGCGCTAACCTTTATTCCACAGTTCACCGTATGGGCAAATGAAGGCATGTTGACTCTG
GTTGAGGGACCGTTCGACGAAACGCTTCTCGACTCGTGTTGGCTGGCGATCGCGGCCACT
GACGACGATACCGTCAACCAGCGCGTCAGCGACGCGGCGGAGTCACGCCGTATCTTTTGC
AACGTGGTGGATGCGCCGAAAGCCGCCAGCTTTATCATGCCCTCCATTATTGACCGCTCG
CCGCTGATGGTCGCCGTCTCCTCGGGCGGCACCTCCCCGGTGCTGGCGCGTCTGCTGCGC
GAGAAACTGGAATCGCTGCTGCCGCAGCATCTGGGGCAGGTCGCGCGCTATGCCGGGCAA
CTCCGCGCCCGAGTGAAAAAGCAGTTTGCCACGATGGGCGAGCGTCGTCGCTTCTGGGAA
AAATTTTTCGTCAATGACCGGCTGGCGCAGTCGCTGGCGAATGCCGATGAGAAAGCGGTT
AACGCGACAACCGAACGCCTGTTTAGCGAACCGCTGGATCACCGTGGCGAAGTCGTGCTG
GTCGGCGCCGGGCCGGGCGATGCCGGACTGCTGACGCTGAAAGGGTTACAACAAATCCAA
CAGGCGGATATCGTGGTTTACGATCGCCTCGTCTCCGACGACATTATGAACCTGGTACGC
CGCGATGCCGATCGGGTCTTTGTGGGGAAACGCGCGGGTTACCACTGCGTCCCACAGGAG
GAAATCAACCAGATCCTGCTGCGTGAAGCGCAAAAAGGTAAACGCGTGGTACGCCTGAAA
GGCGGCGATCCCTTTATCTTTGGTCGCGGCGGCGAAGAGCTGGAAACGCTGTGTCATGCC
GGTATTCCTTTCTCGGTAGTGCCGGGGATTACCGCGGCTTCCGGCTGCTCCGCCTACTCC
GGTATTCCGCTAACTCATCGCGATTACGCCCAGAGCGTACGTCTGGTCACGGGTCACCTG
AAAACCGGCGGCGAGCTGGACTGGGAAAACCTGGCGGCAGAAAAACAGACGCTGGTGTTC
TACATGGGGCTGAATCAGGCAGCGACTATCCAGGAAAAACTGATCGCATTCGGTATGCAG
GCCGATATGCCGGTTGCGCTGGTAGAAAACGGTACCTCCGTGAAGCAACGCGTCGTCCAC
GGTGTGCTGACGCAGCTCGGTGAATTAGCGCAACAGGTTGAAAGCCCGGCGCTGATTATC
GTTGGTCGCGTGGTAGCCTTACGCGATAAATTAAATTGGTTCTCTAATCATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP25924
UniProtKB Entry NameCYSG_SALTY
GenBank Gene IDM64606
General References
  1. Wu JY, Siegel LM, Kredich NM: High-level expression of Escherichia coli NADPH-sulfite reductase: requirement for a cloned cysG plasmid to overcome limiting siroheme cofactor. J Bacteriol. 1991 Jan;173(1):325-33. [PubMed:1987123]
  2. McClelland M, Sanderson KE, Spieth J, Clifton SW, Latreille P, Courtney L, Porwollik S, Ali J, Dante M, Du F, Hou S, Layman D, Leonard S, Nguyen C, Scott K, Holmes A, Grewal N, Mulvaney E, Ryan E, Sun H, Florea L, Miller W, Stoneking T, Nhan M, Waterston R, Wilson RK: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2. Nature. 2001 Oct 25;413(6858):852-6. [PubMed:11677609]
  3. Stroupe ME, Leech HK, Daniels DS, Warren MJ, Getzoff ED: CysG structure reveals tetrapyrrole-binding features and novel regulation of siroheme biosynthesis. Nat Struct Biol. 2003 Dec;10(12):1064-73. Epub 2003 Nov 2. [PubMed:14595395]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails
DB04522DexfosfoserineexperimentalunknownDetails