Monomeric sarcosine oxidase

Details

Name
Monomeric sarcosine oxidase
Synonyms
  • 1.5.3.1
  • MSOX
  • sox
Gene Name
soxA
Organism
Bacillus sp. (strain B-0618)
Amino acid sequence
>lcl|BSEQ0016377|Monomeric sarcosine oxidase
MSTHFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGEGR
EYVPLALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLE
GDEINKRWPGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDIS
PDSVKIETANGSYTADKLIVSMGAWNSKLLSKLNLDIPLQPYRQVVGFFESDESKYSNDI
DFPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGVYPEDESNLRAFLE
EYMPGANGELKRGAVCMYTKTLDEHFIIDLHPEHSNVVIAAGFSGHGFKFSSGVGEVLSQ
LALTGKTEHDISIFSINRPALKESLQKTTI
Number of residues
390
Molecular Weight
43181.395
Theoretical pI
5.28
GO Classification
Functions
sarcosine oxidase activity
Processes
tetrahydrofolate metabolic process
Components
cytoplasm
General Function
Sarcosine oxidase activity
Specific Function
Catalyzes the oxidative demethylation of sarcosine. Can also oxidize other secondary amino acids such as N-methyl-L-alanine.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0002584|1173 bp
ATGAGCACACATTTTGATGTCATCGTTGTTGGAGCTGGATCAATGGGAATGGCGGCAGGT
TATCAATTAGCAAAGCAAGGAGTCAAAACATTATTAGTGGATGCATTTGATCCGCCGCAT
ACAAACGGAAGCCATCACGGTGATACTCGTATCATCCGCCATGCTTACGGTGAGGGAAGA
GAATATGTTCCTCTTGCATTAAGATCACAAGAGTTATGGTATGAACTAGAAAAAGAAACA
CACCATAAAATATTCACGAAAACGGGCGTACTCGTATTTGGTCCTAAAGGTGAATCGGCT
TTCGTTGCAGAAACGATGGAAGCGGCAAAGGAACATTCATTGACTGTTGATTTACTGGAA
GGTGATGAAATAAATAAGCGTTGGCCGGGTATAACGGTTCCGGAAAACTACAATGCTATT
TTCGAACCGAACTCAGGTGTATTATTCAGTGAAAATTGTATTCGTGCCTACCGCGAGTTA
GCTGAAGCGCGAGGTGCTAAAGTTCTAACACATACACGCGTTGAGGACTTTGACATTTCA
CCGGACTCAGTCAAAATCGAAACAGCAAATGGATCATACACAGCTGATAAATTAATTGTT
AGCATGGGAGCTTGGAATAGCAAACTACTTTCAAAACTAAATCTTGACATCCCATTACAG
CCATATCGTCAAGTGGTAGGTTTCTTTGAATCCGATGAATCAAAGTATAGCAATGATATT
GATTTCCCAGGATTCATGGTTGAAGTGCCAAATGGTATTTATTACGGATTCCCAAGCTTC
GGCGGCTGTGGATTGAAACTAGGATATCATACGTTCGGGCAGAAAATTGACCCTGATACA
ATTAATCGCGAATTTGGCGTTTATCCAGAAGATGAAAGTAATCTTCGCGCTTTCTTGGAA
GAATATATGCCAGGAGCAAATGGAGAGTTAAAAAGAGGGGCAGTCTGCATGTACACGAAA
ACATTAGATGAACATTTCATTATAGACTTACATCCTGAACATTCCAACGTAGTCATCGCT
GCCGGCTTCTCTGGCCATGGATTTAAGTTTTCCAGTGGAGTTGGTGAAGTGCTAAGTCAA
TTAGCTTTAACTGGTAAAACAGAGCACGATATTTCAATCTTCTCCATTAACCGTCCTGCT
TTGAAAGAATCGTTACAAAAAACAACTATCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP40859
UniProtKB Entry NameMSOX_BACB0
GenBank Protein ID984788
GenBank Gene IDD16521
General References
  1. Wagner MA, Khanna P, Jorns MS: Structure of the flavocoenzyme of two homologous amine oxidases: monomeric sarcosine oxidase and N-methyltryptophan oxidase. Biochemistry. 1999 Apr 27;38(17):5588-95. [PubMed:10220347]
  2. Wagner MA, Jorns MS: Monomeric sarcosine oxidase: 2. Kinetic studies with sarcosine, alternate substrates, and a substrate analogue. Biochemistry. 2000 Aug 1;39(30):8825-9. [PubMed:10913293]
  3. Zhao G, Qu J, Davis FA, Jorns MS: Inactivation of monomeric sarcosine oxidase by reaction with N-(cyclopropyl)glycine. Biochemistry. 2000 Nov 21;39(46):14341-7. [PubMed:11087383]
  4. Trickey P, Wagner MA, Jorns MS, Mathews FS: Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme. Structure. 1999 Mar 15;7(3):331-45. [PubMed:10368302]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01918[Methyltelluro]AcetateexperimentalunknownDetails
DB02083N,N-dimethylglycineexperimentalunknownDetails
DB02543Pyrrole-2-CarboxylateexperimentalunknownDetails
DB03098[Methylseleno]AcetateexperimentalunknownDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails
DB03366Imidazoleexperimental, investigationalunknownDetails
DB03517[Methylthio]AcetateexperimentalunknownDetails