tRNA (guanine-N(1)-)-methyltransferase

Details

Name
tRNA (guanine-N(1)-)-methyltransferase
Synonyms
  • 2.1.1.228
  • M1G-methyltransferase
  • tRNA [GM37] methyltransferase
Gene Name
trmD
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Amino acid sequence
>lcl|BSEQ0011801|tRNA (guanine-N(1)-)-methyltransferase
MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGM
LMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDE
RLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPH
YTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEA
QAEHNS
Number of residues
246
Molecular Weight
27542.435
Theoretical pI
5.65
GO Classification
Functions
tRNA (guanine(37)-N(1))-methyltransferase activity
Components
cytoplasm
General Function
Trna (guanine(37)-n(1))-methyltransferase activity
Specific Function
Specifically methylates guanosine-37 in various tRNAs.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011802|tRNA (guanine-N(1)-)-methyltransferase (trmD)
ATGTGGATAGGGGTAATTTCATTATTCCCCGAAATGTTTAAAGCAATTACGGAATTTGGG
GTTACAGGTAGAGCCGTAAAACATAATCTTCTGAAAGTTGAATGTTGGAATCCAAGAGAT
TTTACATTCGACAAGCATAAAACCGTGGACGATCGCCCTTATGGTGGTGGCCCAGGAATG
CTAATGATGGTGCAACCTTTACGGGATGCGATTCATACTGCAAAAGCTGCGGCAGGAGAA
GGCGCAAAGGTGATTTACCTTTCGCCACAAGGACGTAAACTCGATCAAGGCGGCGTAACC
GAGCTTGCTCAAAATCAGAAATTGATTTTAGTATGTGGACGTTACGAAGGGATTGATGAA
CGGTTGATTCAAACTGAAATTGATGAAGAATGGTCAATCGGCGATTACGTTCTGACCGGT
GGGGAATTGCCGGCAATGACATTAATTGATGCTGTTGCACGTTTTATTCCCGGTGTATTA
GGCAAACAAGCCTCGGCAGAAGAAGATTCTTTTGCAGATGGTTTATTAGATTGCCCGCAT
TACACTAGACCAGAAGTGTTAGAAGGATTAACTGTACCACCCGTGCTGATGTCGGGACAT
CACGAAGAAATTCGGAAATGGCGATTAAAACAATCGCTACAGAGAACGTGGCTCCGACGC
CCTGAGCTCTTAGAAGGCCTAGCTCTGACTGACGAACAACGTAAGCTGTTAAAAGAGGCG
CAAGCCGAGCATAACAGTTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP43912
UniProtKB Entry NameTRMD_HAEIN
GenBank Gene IDL42023
General References
  1. Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA, Merrick JM, et al.: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd. Science. 1995 Jul 28;269(5223):496-512. [PubMed:7542800]
  2. Ahn HJ, Kim HW, Yoon HJ, Lee BI, Suh SW, Yang JK: Crystal structure of tRNA(m1G37)methyltransferase: insights into tRNA recognition. EMBO J. 2003 Jun 2;22(11):2593-603. [PubMed:12773376]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails