tRNA (cytidine(34)-2'-O)-methyltransferase

Details

Name
tRNA (cytidine(34)-2'-O)-methyltransferase
Synonyms
  • 2.1.1.207
  • tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL
Gene Name
trmL
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Amino acid sequence
>lcl|BSEQ0011796|tRNA (cytidine(34)-2'-O)-methyltransferase
MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRH
KTFEAFLESEKPKRLFALTTKGCPAHSQVKFKLGDYLMFGPETRGIPMSILNEMPMEQKI
RIPMTANSRSMNLSNSVAVTVYEAWRQLGYKGAVNLPEVK
Number of residues
160
Molecular Weight
18401.245
Theoretical pI
9.43
GO Classification
Functions
RNA binding / S-adenosylmethionine-dependent methyltransferase activity / tRNA methyltransferase activity
Components
cytoplasm
General Function
Trna methyltransferase activity
Specific Function
Methylates the ribose at the nucleotide 34 wobble position in the two leucyl isoacceptors tRNA(Leu)(CmAA) and tRNA(Leu)(cmnm5UmAA). Catalyzes the methyl transfer from S-adenosyl-L-methionine to the 2'-OH of the wobble nucleotide.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011797|tRNA (cytidine(34)-2'-O)-methyltransferase (trmL)
ATGTTAGATATCGTTTTATATGAACCAGAAATCCCACAAAATACTGGTAACATTATTCGA
CTTTGTGCCAACACAGGATTTCGCTTGCACTTAATTGAACCACTAGGTTTCACTTGGGAT
GATAAACGCTTACGCCGCTCAGGTTTGGATTATCACGAATTTGCGGAAATCAAACGCCAC
AAAACCTTTGAAGCCTTTTTAGAAAGCGAAAAACCCAAACGCCTTTTTGCACTTACAACA
AAAGGCTGTCCAGCACATAGCCAAGTGAAATTTAAACTTGGGGATTATTTAATGTTTGGC
CCAGAAACTCGTGGCATTCCGATGTCAATTTTAAATGAAATGCCGATGGAACAAAAAATC
CGCATTCCAATGACTGCCAATAGCCGCAGTATGAACTTGTCTAATTCTGTTGCAGTAACG
GTTTATGAAGCGTGGCGACAATTAGGCTATAAAGGTGCGGTAAATTTACCAGAAGTAAAA
TAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP44868
UniProtKB Entry NameTRML_HAEIN
GenBank Gene IDL42023
General References
  1. Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA, Merrick JM, et al.: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd. Science. 1995 Jul 28;269(5223):496-512. [PubMed:7542800]
  2. Lim K, Zhang H, Tempczyk A, Krajewski W, Bonander N, Toedt J, Howard A, Eisenstein E, Herzberg O: Structure of the YibK methyltransferase from Haemophilus influenzae (HI0766): a cofactor bound at a site formed by a knot. Proteins. 2003 Apr 1;51(1):56-67. [PubMed:12596263]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails