Choloylglycine hydrolase

Details

Name
Choloylglycine hydrolase
Synonyms
  • 3.5.1.24
  • Bile salt hydrolase
  • CBAH
  • Conjugated bile acid hydrolase
Gene Name
cbh
Organism
Clostridium perfringens (strain 13 / Type A)
Amino acid sequence
>lcl|BSEQ0019107|Choloylglycine hydrolase
MCTGLALETKDGLHLFGRNMDIEYSFNQSIIFIPRNFKCVNKSNKKELTTKYAVLGMGTI
FDDYPTFADGMNEKGLGCAGLNFPVYVSYSKEDIEGKTNIPVYNFLLWVLANFSSVEEVK
EALKNANIVDIPISENIPNTTLHWMISDITGKSIVVEQTKEKLNVFDNNIGVLTNSPTFD
WHVANLNQYVGLRYNQVPEFKLGDQSLTALGQGTGLVGLPGDFTPASRFIRVAFLRDAMI
KNDKDSIDLIEFFHILNNVAMVRGSTRTVEEKSDLTQYTSCMCLEKGIYYYNTYENNQIN
AIDMNKENLDGNEIKTYKYNKTLSINHVN
Number of residues
329
Molecular Weight
37185.0
Theoretical pI
5.07
GO Classification
Functions
choloylglycine hydrolase activity
General Function
Choloylglycine hydrolase activity
Specific Function
The enzyme catalyzes the degradation of conjugated bile acids in the mammalian gut.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0019108|Choloylglycine hydrolase (cbh)
ATGTGTACAGGATTAGCCTTAGAAACAAAAGATGGATTACATTTGTTTGGAAGAAATATG
GATATTGAATATTCATTTAATCAATCTATTATATTTATTCCTAGGAATTTTAAATGTGTA
AACAAATCAAACAAAAAAGAATTAACAACAAAATATGCTGTTCTTGGAATGGGAACTATT
TTTGATGATTATCCTACCTTTGCAGATGGTATGAATGAAAAGGGATTAGGGTGTGCTGGC
TTAAATTTCCCTGTTTATGTTAGCTATTCTAAAGAAGATATAGAAGGTAAAACTAATATT
CCAGTATATAATTTCTTATTATGGGTTTTAGCTAATTTTAGCTCAGTAGAAGAGGTAAAG
GAAGCATTAAAAAATGCTAATATAGTGGATATACCTATTAGCGAAAATATTCCTAATACA
ACTCTTCATTGGATGATAAGCGATATAACAGGAAAGTCTATTGTGGTTGAACAAACAAAG
GAAAAATTAAATGTATTTGATAATAATATTGGAGTATTAACTAATTCACCTACTTTTGAT
TGGCATGTAGCAAATTTAAATCAATATGTAGGTTTGAGATATAATCAAGTTCCAGAATTT
AAGTTAGGAGATCAATCTTTAACTGCTTTAGGTCAAGGAACTGGTTTAGTAGGATTACCA
GGGGACTTTACACCTGCATCTAGATTTATAAGAGTAGCATTTTTAAGAGATGCAATGATA
AAAAATGATAAAGATTCAATAGACTTAATTGAATTTTTCCATATATTAAATAATGTTGCT
ATGGTAAGAGGATCAACTAGAACTGTAGAAGAAAAAAGTGATCTTACTCAATATACAAGT
TGCATGTGTTTAGAAAAAGGAATTTATTATTATAATACCTATGAAAATAATCAAATTAAT
GCAATAGACATGAATAAAGAAAACTTAGATGGAAATGAAATTAAAACATATAAATACAAC
AAAACTTTAAGTATTAATCATGTAAATTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP54965
UniProtKB Entry NameCBH_CLOPE
GenBank Protein ID882252
GenBank Gene IDU20191
General References
  1. Coleman JP, Hudson LL: Cloning and characterization of a conjugated bile acid hydrolase gene from Clostridium perfringens. Appl Environ Microbiol. 1995 Jul;61(7):2514-20. [PubMed:7618863]
  2. Shimizu T, Ohtani K, Hirakawa H, Ohshima K, Yamashita A, Shiba T, Ogasawara N, Hattori M, Kuhara S, Hayashi H: Complete genome sequence of Clostridium perfringens, an anaerobic flesh-eater. Proc Natl Acad Sci U S A. 2002 Jan 22;99(2):996-1001. Epub 2002 Jan 15. [PubMed:11792842]
  3. Rossocha M, Schultz-Heienbrok R, von Moeller H, Coleman JP, Saenger W: Conjugated bile acid hydrolase is a tetrameric N-terminal thiol hydrolase with specific recognition of its cholyl but not of its tauryl product. Biochemistry. 2005 Apr 19;44(15):5739-48. [PubMed:15823032]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01956Taurineapproved, nutraceuticalunknownDetails
DB02659Cholic AcidapprovedunknownDetails
DB03619Deoxycholic acidapprovedunknownDetails