Oxygen-insensitive NAD(P)H nitroreductase

Details

Name
Oxygen-insensitive NAD(P)H nitroreductase
Synonyms
  • 1.-.-.-
  • nfnB
  • nfsI
  • NR
Gene Name
nfsB
Organism
Enterobacter cloacae
Amino acid sequence
>lcl|BSEQ0016966|Oxygen-insensitive NAD(P)H nitroreductase
MDIISVALKRHSTKAFDASKKLTAEEAEKIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGTYVFNERKMLDASHVVVFCAKTAMDDAWLERVVDQEEADGRFNTPEAKAANHKG
RTYFADMHRVDLKDDDQWMAKQVYLNVGNFLLGVGAMGLDAVPIEGFDAAILDEEFGLKE
KGFTSLVVVPVGHHSVEDFNATLPKSRLPLSTIVTEC
Number of residues
217
Molecular Weight
23949.98
Theoretical pI
5.61
GO Classification
Functions
oxidoreductase activity
General Function
Oxidoreductase activity
Specific Function
Reduction of a variety of nitroaromatic compounds using NADH (and to lesser extent NADPH) as source of reducing equivalents; two electrons are transferred.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005921|654 bp
ATGGATATCATTTCTGTCGCCCTGAAACGCCACTCTACCAAGGCGTTCGACGCAAGCAAA
AAACTGACCGCGGAAGAAGCGGAAAAAATCAAAACCCTGCTGCAGTACAGCCCGTCCAGC
ACCAACTCCCAGCCGTGGCACTTCATTGTAGCCAGCACCGAGGAAGGAAAAGCGCGCGTG
GCGAAGTCCGCTGCGGGCACCTATGTGTTCAACGAACGCAAAATGCTGGATGCTTCCCAC
GTGGTGGTGTTCTGCGCGAAAACCGCGATGGATGACGCCTGGCTGGAGCGCGTCGTGGAT
CAGGAAGAGGCCGATGGCCGTTTCAACACGCCGGAAGCCAAAGCCGCAAACCATAAGGGC
CGCACCTACTTCGCCGACATGCACCGCGTGGATCTGAAAGATGACGACCAGTGGATGGCG
AAGCAGGTTTACCTGAACGTCGGCAACTTCCTGCTGGGCGTGGGCGCGATGGGTCTGGAC
GCGGTACCAATTGAAGGTTTCGACGCCGCTATTCTCGACGAAGAGTTTGGCCTGAAAGAG
AAAGGCTTCACCAGCCTGGTGGTGGTACCGGTTGGGCACCACAGCGTGGAAGATTTCAAC
GCCACGCTGCCGAAATCTCGCCTGCCGCTGAGCACGATTGTGACCGAGTGCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ01234
UniProtKB Entry NameNFSB_ENTCL
GenBank Gene IDM63808
General References
  1. Bryant C, Hubbard L, McElroy WD: Cloning, nucleotide sequence, and expression of the nitroreductase gene from Enterobacter cloacae. J Biol Chem. 1991 Mar 5;266(7):4126-30. [PubMed:1999406]
  2. Bryant C, DeLuca M: Purification and characterization of an oxygen-insensitive NAD(P)H nitroreductase from Enterobacter cloacae. J Biol Chem. 1991 Mar 5;266(7):4119-25. [PubMed:1999405]
  3. Haynes CA, Koder RL, Miller AF, Rodgers DW: Structures of nitroreductase in three states: effects of inhibitor binding and reduction. J Biol Chem. 2002 Mar 29;277(13):11513-20. Epub 2002 Jan 22. [PubMed:11805110]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails
DB03793Benzoic acidapproved, investigationalunknownDetails