Growth hormone-releasing hormone receptor

Details

Name
Growth hormone-releasing hormone receptor
Synonyms
  • GHRH receptor
  • GRF receptor
  • GRFR
  • Growth hormone-releasing factor receptor
Gene Name
GHRHR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016157|Growth hormone-releasing hormone receptor
MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWD
GLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLA
EEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVF
LKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRR
AFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLF
LNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPL
ELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLT
SMC
Number of residues
423
Molecular Weight
47401.53
Theoretical pI
6.73
GO Classification
Functions
G-protein coupled receptor activity / growth factor binding / growth hormone-releasing hormone receptor activity / peptide hormone binding
Processes
activation of adenylate cyclase activity / adenylate cyclase-activating G-protein coupled receptor signaling pathway / cAMP-mediated signaling / cell maturation / cell surface receptor signaling pathway / cellular response to insulin stimulus / determination of adult lifespan / growth hormone secretion / hormone metabolic process / lactation / multicellular organismal reproductive process / positive regulation of cAMP biosynthetic process / positive regulation of cell proliferation / positive regulation of growth hormone secretion / positive regulation of insulin-like growth factor receptor signaling pathway / positive regulation of multicellular organism growth / regulation of intracellular steroid hormone receptor signaling pathway / regulation of protein metabolic process / response to estrogen / response to glucocorticoid / response to insulin / somatotropin secreting cell development / water homeostasis
Components
cell surface / cytoplasm / integral component of membrane / nuclear inner membrane / nuclear matrix / nuclear outer membrane / plasma membrane / secretory granule
General Function
Peptide hormone binding
Specific Function
Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
Pfam Domain Function
Transmembrane Regions
133-152 163-181 205-227 241-262 281-304 330-348 362-381
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016158|Growth hormone-releasing hormone receptor (GHRHR)
ATGGACCGCCGGATGTGGGGGGCCCACGTCTTCTGCGTGTTGAGCCCGTTACCGACCGTA
TTGGGCCACATGCACCCAGAATGTGACTTCATCACCCAGCTGAGAGAGGATGAGAGTGCC
TGTCTACAAGCAGCAGAGGAGATGCCCAACACCACCCTGGGCTGCCCTGCGACCTGGGAT
GGGCTGCTGTGCTGGCCAACGGCAGGCTCTGGCGAGTGGGTCACCCTCCCCTGCCCGGAT
TTCTTCTCTCACTTCAGCTCAGAGTCAGGGGCTGTGAAACGGGATTGTACTATCACTGGC
TGGTCTGAGCCCTTTCCACCTTACCCTGTGGCCTGCCCTGTGCCTCTGGAGCTGCTGGCT
GAGGAGGAATCTTACTTCTCCACAGTGAAGATTATCTACACCGTGGGCCATAGCATCTCT
ATTGTAGCCCTCTTCGTGGCCATCACCATCCTGGTTGCTCTCAGGAGGCTCCACTGCCCC
CGGAACTACGTCCACACCCAGCTGTTCACCACTTTTATCCTCAAGGCGGGAGCTGTGTTC
CTGAAGGATGCTGCCCTTTTCCACAGCGACGACACTGACCACTGCAGCTTCTCCACTGTT
CTATGCAAGGTCTCTGTGGCCGCCTCCCATTTCGCCACCATGACCAACTTCAGCTGGCTG
TTGGCAGAAGCCGTCTACCTGAACTGCCTCCTGGCCTCCACCTCCCCCAGCTCAAGGAGA
GCCTTCTGGTGGCTGGTTCTCGCTGGCTGGGGGCTGCCCGTGCTCTTCACTGGCACGTGG
GTGAGCTGCAAACTGGCCTTCGAGGACATCGCGTGCTGGGACCTGGACGACACCTCCCCC
TACTGGTGGATCATCAAAGGGCCCATTGTCCTCTCGGTCGGGGTGAACTTTGGGCTTTTT
CTCAATATTATCCGCATCCTGGTGAGGAAACTGGAGCCAGCTCAGGGCAGCCTCCATACC
CAGTCTCAGTATTGGCGTCTCTCCAAGTCGACACTTTTCCTGATCCCACTCTTTGGAATT
CACTACATCATCTTCAACTTCCTGCCAGACAATGCTGGCCTGGGCATCCGCCTCCCCCTG
GAGCTGGGACTGGGTTCCTTCCAGGGCTTCATTGTTGCCATCCTCTACTGCTTCCTCAAC
CAAGAGGTGAGGACTGAGATCTCACGGAAGTGGCATGGCCATGACCCTGAGCTTCTGCCA
GCCTGGAGGACCCGTGCTAAGTGGACCACGCCTTCCCGCTCGGCGGCAAAGGTGCTGACA
TCTATGTGCTAG
Chromosome Location
7
Locus
7p14
External Identifiers
ResourceLink
UniProtKB IDQ02643
UniProtKB Entry NameGHRHR_HUMAN
GenBank Protein ID183173
GenBank Gene IDL01406
GenAtlas IDGHRHR
HGNC IDHGNC:4266
General References
  1. Mayo KE: Molecular cloning and expression of a pituitary-specific receptor for growth hormone-releasing hormone. Mol Endocrinol. 1992 Oct;6(10):1734-44. [PubMed:1333056]
  2. Gaylinn BD, Harrison JK, Zysk JR, Lyons CE, Lynch KR, Thorner MO: Molecular cloning and expression of a human anterior pituitary receptor for growth hormone-releasing hormone. Mol Endocrinol. 1993 Jan;7(1):77-84. [PubMed:7680413]
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948]
  4. Salvatori R, Fan X, Phillips JA 3rd, Espigares-Martin R, Martin De Lara I, Freeman KL, Plotnick L, Al-Ashwal A, Levine MA: Three new mutations in the gene for the growth hormone (gh)-releasing hormone receptor in familial isolated gh deficiency type ib. J Clin Endocrinol Metab. 2001 Jan;86(1):273-9. [PubMed:11232012]
  5. Salvatori R, Hayashida CY, Aguiar-Oliveira MH, Phillips JA 3rd, Souza AH, Gondo RG, Toledo SP, Conceicao MM, Prince M, Maheshwari HG, Baumann G, Levine MA: Familial dwarfism due to a novel mutation of the growth hormone-releasing hormone receptor gene. J Clin Endocrinol Metab. 1999 Mar;84(3):917-23. [PubMed:10084571]
  6. Carakushansky M, Whatmore AJ, Clayton PE, Shalet SM, Gleeson HK, Price DA, Levine MA, Salvatori R: A new missense mutation in the growth hormone-releasing hormone receptor gene in familial isolated GH deficiency. Eur J Endocrinol. 2003 Jan;148(1):25-30. [PubMed:12534354]
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00010Sermorelinapproved, withdrawnyesagonistDetails
DB08869Tesamorelinapproved, investigationalyesbinderDetails