Identification

Name
Sermorelin
Accession Number
DB00010  (BTD00033, BIOD00033)
Type
Biotech
Groups
Approved, Withdrawn
Biologic Classification
Protein Based Therapies
Hormones
Description

Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues

Protein chemical formula
C149H246N44O42S
Protein average weight
3357.882 Da
Sequences
>DB00010 sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Download FASTA Format
Synonyms
Not Available
Product Ingredients
IngredientUNIICASInChI Key
Sermorelin acetate00IBG87IQW114466-38-5Not applicable
International/Other Brands
Geref (Serono Pharma)
Categories
UNII
89243S03TE
CAS number
86168-78-7

Pharmacology

Indication

For the treatment of dwarfism, prevention of HIV-induced weight loss

Structured Indications
Not Available
Pharmacodynamics

Sermorelin is used in the treatment of children with growth hormone deficiency or growth failure. Geref increases plasma growth hormone (GH) concentration by stimulating the pituitary gland to release GH. Geref is similar to the full-length native hormone (44 residues) in its ability to stimulate GH secretion in humans.

Mechanism of action

Sermorelin binds to the growth hormone releasing hormone receptor and mimics native GRF in its ability to stimulate growth hormone secretion.

TargetActionsOrganism
AGrowth hormone-releasing hormone receptor
agonist
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

11-12 min

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
No interactions found.
Food Interactions
Not Available

References

General References
Not Available
External Links
KEGG Compound
C08192
PubChem Substance
46507399
Therapeutic Targets Database
DAP001055
PharmGKB
PA164749110
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Sermorelin
ATC Codes
V04CD03 — SermorelinH01AC04 — Sermorelin

Clinical Trials

Clinical Trials
Not Available

Pharmacoeconomics

Manufacturers
  • Emd serono inc
Packagers
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.330Not Available
isoelectric point9.99Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Peptide hormone binding
Specific Function
Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
Gene Name
GHRHR
Uniprot ID
Q02643
Uniprot Name
Growth hormone-releasing hormone receptor
Molecular Weight
47401.53 Da
References
  1. Esposito P, Barbero L, Caccia P, Caliceti P, D'Antonio M, Piquet G, Veronese FM: PEGylation of growth hormone-releasing hormone (GRF) analogues. Adv Drug Deliv Rev. 2003 Sep 26;55(10):1279-91. [PubMed:14499707]
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Drug created on June 13, 2005 07:24 / Updated on November 06, 2017 06:43