NADPH-flavin oxidoreductase

Details

Name
NADPH-flavin oxidoreductase
Synonyms
  • 1.6.99.-
  • Flavin reductase P
  • NADPH-FMN oxidoreductase
Gene Name
frp
Organism
Vibrio harveyi
Amino acid sequence
>lcl|BSEQ0011865|NADPH-flavin oxidoreductase
MNNTIETILAHRSIRKFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIVRVTDSEKRNEL
AQFAGNQAYVESAAEFLVFCIDYQRHATINPDVQADFTELTLIGAVDSGIMAQNCLLAAE
SMGLGGVYIGGLRNSAAQVDELLGLPENSAVLFGMCLGHPDQNPEVKPRLPAHVVVHENQ
YQELNLDDIQSYDQTMQAYYASRTSNQKLSTWSQEVTGKLAGESRPHILPYLNSKGLAKR
Number of residues
240
Molecular Weight
26309.475
Theoretical pI
5.06
GO Classification
Functions
oxidoreductase activity
Processes
bioluminescence
General Function
Oxidoreductase activity
Specific Function
Involved in bioluminescence. It is a good supplier of reduced flavin mononucleotide (FMNH2) to the bioluminescence reaction.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005155|723 bp
ATGAACAATACGATTGAAACCATTCTTGCTCATCGCTCTATCCGAAAATTCACCGCAGTT
CCTATTACTGATGAACAAAGACAAACCATCATTCAAGCAGGTTTAGCTGCGTCTTCTTCT
AGTATGCTTCAAGTCGTCTCAATCGTTCGAGTGACTGACTCTGAAAAGCGTAACGAATTG
GCTCAATTTGCTGGTAACCAAGCTTATGTTGAAAGTGCGGCTGAGTTCTTAGTGTTTTGT
ATTGATTATCAGCGCCATGCAACCATCAATCCTGATGTACAGGCAGACTTTACAGAACTA
ACTCTGATTGGAGCAGTAGATTCTGGAATCATGGCACAAAACTGCTTGCTTGCAGCCGAG
TCTATGGGATTAGGTGGCGTATATATTGGAGGACTAAGGAATAGCGCAGCTCAAGTTGAT
GAGCTATTGGGCTTACCGGAAAATAGCGCGGTGTTGTTTGGTATGTGCTTAGGGCATCCC
GATCAAAATCCCGAAGTAAAGCCACGCCTACCTGCACATGTGGTTGTTCATGAAAATCAA
TACCAAGAGCTAAATTTAGATGATATTCAGAGCTACGATCAAACTATGCAAGCGTATTAT
GCGAGCCGTACAAGCAATCAAAAACTGAGTACATGGTCGCAAGAAGTCACTGGGAAGCTT
GCTGGTGAGTCGCGACCTCATATTCTGCCGTACTTGAACAGTAAGGGGCTAGCAAAACGC
TAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ56691
UniProtKB Entry NameFRP_VIBHA
GenBank Gene IDU08996
General References
  1. Lei B, Liu M, Huang S, Tu SC: Vibrio harveyi NADPH-flavin oxidoreductase: cloning, sequencing and overexpression of the gene and purification and characterization of the cloned enzyme. J Bacteriol. 1994 Jun;176(12):3552-8. [PubMed:8206832]
  2. Tanner JJ, Lei B, Tu SC, Krause KL: Flavin reductase P: structure of a dimeric enzyme that reduces flavin. Biochemistry. 1996 Oct 22;35(42):13531-9. [PubMed:8885832]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails