Intracellular hyaluronan-binding protein 4

Details

Name
Intracellular hyaluronan-binding protein 4
Synonyms
  • IHABP-4
  • Ki-1/57 intracellular antigen
Gene Name
HABP4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008721|Intracellular hyaluronan-binding protein 4
MKGALGSPVAAAGAAMQESFGCVVANRFHQLLDDESDPFDILREAERRRQQQLQRKRRDE
AAAAAGAGPRGGRSPAGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKR
TPRRGEQQGWNDSRGPEGMLERAERRSYREYRPYETERQADFTAEKFPDEKPGDRFDRDR
PLRGRGGPRGGMRGRGRGGPGNRVFDAFDQRGKREFERYGGNDKIAVRTEDNMGGCGVRT
WGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPELEVEEETQVQEMTLDEWKNLQ
EQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFRKPANDITSQLEIN
FGNLPRPGRGARGGTRGGRGRIRRAENYGPRAEVVMQDVAPNPDDPEDFPALS
Number of residues
413
Molecular Weight
45785.09
Theoretical pI
Not Available
GO Classification
Processes
blood coagulation / cellular response to mechanical stimulus / negative regulation of DNA binding / platelet activation / platelet degranulation / regulation of transcription, DNA-templated / transcription, DNA-templated
Components
cytoplasm / cytosol / extracellular region / nucleoplasm / nucleus / sarcomere
General Function
Not Available
Specific Function
May be involved in nuclear functions such as the remodeling of chromatin and the regulation of transcription.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0013376|Intracellular hyaluronan-binding protein 4 (HABP4)
ATGAAGGGCGCTCTGGGGAGTCCCGTGGCTGCCGCTGGCGCCGCGATGCAGGAGAGTTTC
GGCTGCGTGGTGGCCAACCGCTTCCATCAGCTGCTGGACGACGAGTCGGACCCGTTCGAC
ATCCTGCGCGAGGCCGAGCGCCGGCGCCAGCAGCAGCTGCAGCGCAAGAGGCGCGACGAG
GCGGCGGCGGCGGCCGGGGCCGGTCCCCGCGGCGGCAGGAGCCCAGCCGGGGCCTCGGGC
CACAGAGCCGGCGCGGGCGGCCGGAGGGAGTCGCAGAAGGAGCGCAAGAGCCTCCCGGCG
CCCGTCGCTCAGCGGCCCGATAGCCCCGGGGGCGGCCTGCAGGCGCCGGGCCAGAAGCGG
ACTCCTAGAAGAGGGGAGCAGCAAGGATGGAATGACAGCCGTGGGCCGGAGGGGATGCTC
GAAAGAGCTGAGCGGAGATCCTACAGGGAATACCGACCCTATGAGACAGAGAGGCAGGCA
GACTTCACAGCTGAGAAGTTTCCAGATGAAAAACCAGGTGATAGGTTTGATCGAGACAGA
CCGTTGAGAGGACGTGGAGGCCCGAGAGGGGGTATGCGCGGCAGAGGCAGAGGTGGCCCT
GGGAACAGAGTTTTTGACGCTTTTGACCAGAGAGGAAAGCGAGAATTTGAAAGATATGGT
GGGAATGACAAAATAGCAGTCAGAACTGAAGACAACATGGGTGGATGTGGAGTTCGAACC
TGGGGATCGGGTAAAGATACCAGTGATGTGGAGCCAACTGCACCGATGGAGGAACCCACA
GTGGTGGAGGAGTCCCAGGGCACCCCGGAAGAGGAGTCTCCAGCCAAAGTTCCTGAGTTG
GAGGTAGAAGAAGAAACCCAAGTTCAAGAGATGACTTTAGATGAGTGGAAAAATCTTCAA
GAACAGACCAGACCAAAGCCTGAGTTTAACATCCGGAAACCAGAATCCACTGTTCCTTCC
AAAGCCGTGGTGATTCACAAGTCAAAATACAGAGATGATATGGTAAAAGATGACTATGAG
GACGATTCCCATGTTTTCCGGAAACCCGCCAATGACATCACATCCCAGCTGGAGATTAAT
TTTGGTAACCTCCCTCGTCCTGGGCGTGGAGCCAGAGGAGGCACCCGGGGAGGCCGGGGA
AGGATCAGGAGGGCAGAGAACTATGGACCCAGAGCAGAAGTGGTGATGCAAGATGTTGCC
CCCAACCCAGATGACCCGGAAGATTTCCCTGCGCTGTCTTGA
Chromosome Location
9
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ5JVS0
UniProtKB Entry NameHABP4_HUMAN
HGNC IDHGNC:17062
General References
  1. Huang L, Grammatikakis N, Yoneda M, Banerjee SD, Toole BP: Molecular characterization of a novel intracellular hyaluronan-binding protein. J Biol Chem. 2000 Sep 22;275(38):29829-39. [PubMed:10887182]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Kobarg J, Schnittger S, Fonatsch C, Lemke H, Bowen MA, Buck F, Hansen HP: Characterization, mapping and partial cDNA sequence of the 57-kD intracellular Ki-1 antigen. Exp Clin Immunogenet. 1997;14(4):273-80. [PubMed:9523163]
  5. Lemos TA, Passos DO, Nery FC, Kobarg J: Characterization of a new family of proteins that interact with the C-terminal region of the chromatin-remodeling factor CHD-3. FEBS Lett. 2003 Jan 2;533(1-3):14-20. [PubMed:12505151]
  6. Nery FC, Passos DO, Garcia VS, Kobarg J: Ki-1/57 interacts with RACK1 and is a substrate for the phosphorylation by phorbol 12-myristate 13-acetate-activated protein kinase C. J Biol Chem. 2004 Mar 19;279(12):11444-55. Epub 2003 Dec 29. [PubMed:14699138]
  7. Nery FC, Rui E, Kuniyoshi TM, Kobarg J: Evidence for the interaction of the regulatory protein Ki-1/57 with p53 and its interacting proteins. Biochem Biophys Res Commun. 2006 Mar 17;341(3):847-55. Epub 2006 Jan 23. [PubMed:16455055]
  8. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  9. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  10. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  11. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08818Hyaluronic acidapproved, vet_approvedunknownbinderDetails