Neuropeptide S receptor

Details

Name
Neuropeptide S receptor
Synonyms
  • G-protein coupled receptor 154
  • G-protein coupled receptor for asthma susceptibility
  • G-protein coupled receptor PGR14
  • GPR154
  • GPRA
  • PGR14
Gene Name
NPSR1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001888|Neuropeptide S receptor
MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF
VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV
CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP
TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK
SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN
LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH
EMQILSKPEFI
Number of residues
371
Molecular Weight
42686.28
Theoretical pI
8.44
GO Classification
Functions
neuropeptide receptor activity / vasopressin receptor activity
Processes
eating behavior / negative regulation of defecation / negative regulation of eating behavior / neuropeptide signaling pathway / positive regulation of ERK1 and ERK2 cascade / positive regulation of release of sequestered calcium ion into cytosol / righting reflex
Components
cytoplasm / integral component of plasma membrane / plasma membrane
General Function
Vasopressin receptor activity
Specific Function
G-protein coupled receptor for neuropeptide S (NPS) (PubMed:16790440). Promotes mobilization of intracellular Ca(2+) stores (PubMed:16790440). Inhibits cell growth in response to NPS binding (PubMed:15947423). Involved in pathogenesis of asthma and other IgE-mediated diseases.
Pfam Domain Function
Transmembrane Regions
53-73 83-103 124-144 165-185 213-233 276-296 313-333
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010667|Neuropeptide S receptor (NPSR1)
ATGCCAGCCAACTTCACAGAGGGCAGCTTCGATTCCAGTGGGACCGGGCAGACGCTGGAT
TCTTCCCCAGTGGCTTGCACTGAAACAGTGACTTTTACTGAAGTGGTGGAAGGAAAGGAA
TGGGGTTCCTTCTACTACTCCTTTAAGACTGAGCAATTGATAACTCTGTGGGTCCTCTTT
GTTTTTACCATTGTTGGAAACTCCGTTGTGCTTTTTTCCACATGGAGGAGAAAGAAGAAG
TCAAGAATGACCTTCTTTGTGACTCAGCTGGCCATCACAGATATTAATTGGCGATTCACT
GGAGACTTCACGGCACCTGACCTGGTTTGCCGAGTGGTCCGCTATTTGCAGGTTGTGCTG
CTCTACGCCTCTACCTACGTCCTGGTGTCCCTCAGCATAGACAGATACCATGCCATCGTC
TACCCCATGAAGTTCCTTCAAGGAGAAAAGCAAGCCAGGGTCCTCATTGTGATCGCCTGG
AGCCTGTCTTTTCTGTTCTCCATTCCCACCCTGATCATATTTGGGAAGAGGACACTGTCC
AACGGTGAAGTGCAGTGCTGGGCCCTGTGGCCTGACGACTCCTACTGGACCCCATACATG
ACCATCGTGGCCTTCCTGGTGTACTTCATCCCTCTGACAATCATCAGCATCATGTATGGC
ATTGTGATCCGAACTATTTGGATTAAAAGCAAAACCTACGAAACAGTGATTTCCAACTGC
TCAGATGGGAAACTGTGCAGCAGCTATAACCGAGGACTCATCTCAAAGGCAAAAATCAAG
GCTATCAAGTATAGCATCATCATCATTCTTGCCTTCATCTGCTGTTGGAGTCCATACTTC
CTGTTTGACATTTTGGACAATTTCAACCTCCTTCCAGACACCCAGGAGCGTTTCTATGCC
TCTGTGATCATTCAGAACCTGCCAGCATTGAATAGTGCCATCAACCCCCTCATCTACTGT
GTCTTCAGCAGCTCCATCTCTTTCCCCTGCAGGGTCATCCGTCTCCGTCAGCTCCAGGAG
GCTGCGCTAATGCTCTGCCCTCAACGAGAGAACTGGAAGGGTACTTGGCCAGGTGTACCT
TCCTGGGCTCTTCCAAGGTGA
Chromosome Location
7
Locus
7p14.3
External Identifiers
ResourceLink
UniProtKB IDQ6W5P4
UniProtKB Entry NameNPSR1_HUMAN
GenBank Protein ID34596864
GenBank Gene IDAY310326
GenAtlas IDNPSR1
HGNC IDHGNC:23631
General References
  1. Laitinen T, Polvi A, Rydman P, Vendelin J, Pulkkinen V, Salmikangas P, Makela S, Rehn M, Pirskanen A, Rautanen A, Zucchelli M, Gullsten H, Leino M, Alenius H, Petays T, Haahtela T, Laitinen A, Laprise C, Hudson TJ, Laitinen LA, Kere J: Characterization of a common susceptibility locus for asthma-related traits. Science. 2004 Apr 9;304(5668):300-4. [PubMed:15073379]
  2. Vendelin J, Pulkkinen V, Rehn M, Pirskanen A, Raisanen-Sokolowski A, Laitinen A, Laitinen LA, Kere J, Laitinen T: Characterization of GPRA, a novel G protein-coupled receptor related to asthma. Am J Respir Cell Mol Biol. 2005 Sep;33(3):262-70. Epub 2005 Jun 9. [PubMed:15947423]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Xu YL, Reinscheid RK, Huitron-Resendiz S, Clark SD, Wang Z, Lin SH, Brucher FA, Zeng J, Ly NK, Henriksen SJ, de Lecea L, Civelli O: Neuropeptide S: a neuropeptide promoting arousal and anxiolytic-like effects. Neuron. 2004 Aug 19;43(4):487-97. [PubMed:15312648]
  6. Melen E, Bruce S, Doekes G, Kabesch M, Laitinen T, Lauener R, Lindgren CM, Riedler J, Scheynius A, van Hage-Hamsten M, Kere J, Pershagen G, Wickman M, Nyberg F: Haplotypes of G protein-coupled receptor 154 are associated with childhood allergy and asthma. Am J Respir Crit Care Med. 2005 May 15;171(10):1089-95. Epub 2005 Feb 11. [PubMed:15710598]
  7. Kormann MS, Carr D, Klopp N, Illig T, Leupold W, Fritzsch C, Weiland SK, von Mutius E, Kabesch M: G-Protein-coupled receptor polymorphisms are associated with asthma in a large German population. Am J Respir Crit Care Med. 2005 Jun 15;171(12):1358-62. Epub 2005 Mar 11. [PubMed:15764725]
  8. Bernier V, Stocco R, Bogusky MJ, Joyce JG, Parachoniak C, Grenier K, Arget M, Mathieu MC, O'Neill GP, Slipetz D, Crackower MA, Tan CM, Therien AG: Structure-function relationships in the neuropeptide S receptor: molecular consequences of the asthma-associated mutation N107I. J Biol Chem. 2006 Aug 25;281(34):24704-12. Epub 2006 Jun 20. [PubMed:16790440]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01159Halothaneapproved, vet_approvedunknownother/unknownDetails