Solute carrier organic anion transporter family member 4C1

Details

Name
Solute carrier organic anion transporter family member 4C1
Synonyms
  • OATP-H
  • OATP-M1
  • OATP4C1
  • OATPX
  • Organic anion transporter M1
  • SLC21A20
  • Solute carrier family 21 member 20
Gene Name
SLCO4C1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012539|Solute carrier organic anion transporter family member 4C1
MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPE
PSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPGGFLLHYCLLAVTQGI
VVNGLVNISISTVEKRYEMKSSLTGLISSSYDISFCLLSLFVSFFGERGHKPRWLAFAAF
MIGLGALVFSLPQFFSGEYKLGSLFEDTCVTTRNSTSCTSSTSSLSNYLYVFILGQLLLG
AGGTPLYTLGTAFLDDSVPTHKSSLYIGTGYAMSILGPAIGYVLGGQLLTIYIDVAMGES
TDVTEDDPRWLGAWWIGFLLSWIFAWSLIIPFSCFPKHLPGTAEIQAGKTSQAHQSNSNA
DVKFGKSIKDFPAALKNLMKNAVFMCLVLSTSSEALITTGFATFLPKFIENQFGLTSSFA
ATLGGAVLIPGAALGQILGGFLVSKFRMTCKNTMKFALFTSGVALTLSFVFMYAKCENEP
FAGVSESYNGTGELGNLIAPCNANCNCSRSYYYPVCGDGVQYFSPCFAGCSNPVAHRKPK
VYYNCSCIERKTEITSTAETFGFEAKAGKCETHCAKLPIFLCIFFIVIIFTFMAGTPITV
SILRCVNHRQRSLALGIQFMVLRLLGTIPGPIIFGFTIDSTCILWDINDCGIKGACWIYD
NIKMAHMLVAISVTCKVITMFFNGFAIFLYKPPPSATDVSFHKENAVVTNVLAEQDLNKI
VKEG
Number of residues
724
Molecular Weight
78947.525
Theoretical pI
7.57
GO Classification
Functions
sodium-independent organic anion transmembrane transporter activity
Processes
anion transmembrane transport / cell differentiation / multicellular organismal development / sodium-independent organic anion transport / spermatogenesis / transmembrane transport
Components
basolateral plasma membrane / extracellular exosome / integral component of plasma membrane / plasma membrane
General Function
Sodium-independent organic anion transmembrane transporter activity
Specific Function
Organic anion transporter, capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate and cAMP. May participate in the regulation of membrane transport of ouabain. Involved in the uptake of the dipeptidyl peptidase-4 inhibitor sitagliptin and hence may play a role in its transport into and out of renal proximal tubule cells. May be involved in the first step of the transport pathway of digoxin and various compounds into the urine in the kidney. May be involved in sperm maturation by enabling directed movement of organic anions and compounds within or between cells. This ion-transporting process is important to maintain the strict epididymal homeostasis necessary for sperm maturation. May have a role in secretory functions since seminal vesicle epithelial cells are assumed to secrete proteins involved in decapacitation by modifying surface proteins to facilitate the acquisition of the ability to fertilize the egg.
Pfam Domain Function
Transmembrane Regions
106-126 146-166 173-197 224-254 275-295 312-336 378-399 420-443 448-471 581-603 613-638 673-690
Cellular Location
Basolateral cell membrane
Gene sequence
>lcl|BSEQ0012540|Solute carrier organic anion transporter family member 4C1 (SLCO4C1)
ATGAAGAGCGCCAAAGGTATTGAGAACTTGGCTTTTGTCCCCTCCAGCCCAGACATCCTG
CGCCGCTTGTCTGCGTCGCCCTCCCAAATCGAAGTCTCTGCCTTGTCCTCTGACCCCCAA
AGAGAGAATTCTCAGCCACAGGAGCTTCAGAAGCCCCAGGAGCCCCAGAAGTCACCAGAG
CCATCTCTGCCTTCAGCCCCTCCCAATGTCTCCGAAGAGAAGCTCCGGTCACTGTCGCTG
TCCGAGTTTGAGGAGGGGTCTTACGGCTGGAGGAACTTCCATCCTCAATGTCTCCAGCGC
TGCAACACACCTGGAGGCTTTCTGCTTCACTACTGCCTCTTGGCCGTCACGCAAGGTATT
GTAGTTAATGGCCTAGTAAATATTAGCATTTCCACTGTTGAGAAGCGTTATGAAATGAAG
AGTTCCCTGACTGGCCTGATTTCATCAAGCTACGATATTTCATTCTGTTTGTTGTCTTTA
TTTGTATCATTCTTTGGTGAAAGAGGACATAAGCCGAGATGGCTTGCATTTGCAGCCTTT
ATGATTGGACTGGGAGCACTTGTATTCTCATTGCCACAATTTTTCAGTGGAGAATATAAA
TTGGGGTCTCTTTTTGAAGACACTTGTGTAACAACAAGGAATAGCACCAGTTGTACATCT
TCAACTTCTTCACTTTCTAACTACTTGTATGTCTTCATCTTGGGACAACTATTGCTGGGG
GCAGGAGGAACTCCTCTTTATACTCTGGGAACAGCCTTTCTTGATGATTCTGTGCCCACA
CACAAGTCTTCTCTCTATATAGGAACCGGTTATGCTATGTCAATCTTAGGCCCTGCTATT
GGCTATGTATTGGGAGGACAACTGCTAACCATATACATTGATGTTGCTATGGGAGAAAGC
ACTGATGTCACTGAGGATGATCCGCGATGGTTGGGAGCTTGGTGGATTGGGTTTCTTCTA
TCATGGATCTTTGCTTGGTCTTTAATAATACCTTTTTCTTGCTTTCCAAAACATTTACCA
GGTACAGCAGAAATTCAAGCTGGAAAAACTTCCCAGGCTCATCAGAGTAATAGTAATGCA
GATGTGAAATTTGGAAAAAGTATTAAAGATTTTCCAGCTGCTCTAAAGAATTTGATGAAG
AATGCTGTCTTTATGTGTTTAGTTCTATCAACTTCTTCAGAAGCCTTAATTACTACTGGA
TTTGCTACATTTTTACCTAAATTTATAGAAAATCAATTCGGATTGACATCCAGCTTCGCA
GCTACTCTTGGAGGGGCTGTTTTAATTCCTGGAGCTGCTCTCGGTCAAATTTTAGGTGGC
TTCCTTGTTTCAAAATTCAGAATGACATGTAAAAACACAATGAAGTTTGCACTGTTCACA
TCTGGAGTTGCACTTACGCTGAGTTTTGTATTTATGTATGCCAAATGTGAAAATGAGCCA
TTTGCTGGTGTATCTGAATCATATAATGGGACTGGAGAATTGGGAAACTTGATAGCCCCT
TGTAATGCCAATTGTAACTGTTCGCGATCATATTATTATCCTGTCTGTGGAGATGGAGTC
CAATATTTTTCTCCCTGCTTTGCAGGCTGTTCAAACCCAGTTGCACACAGGAAGCCAAAG
GTATATTACAACTGTTCCTGTATTGAAAGGAAAACAGAAATAACATCCACTGCAGAAACT
TTTGGTTTTGAAGCTAAAGCTGGAAAATGTGAAACTCATTGTGCGAAACTGCCCATATTC
CTTTGCATTTTCTTTATTGTAATTATTTTTACCTTTATGGCCGGTACTCCTATAACTGTG
TCTATCCTAAGGTGTGTTAATCACAGACAACGGTCCCTAGCCTTGGGAATACAATTTATG
GTCCTTCGATTATTAGGGACAATTCCTGGACCAATTATATTTGGTTTCACAATAGACAGC
ACATGTATTCTTTGGGATATAAATGATTGTGGAATTAAAGGAGCTTGCTGGATTTATGAT
AACATCAAGATGGCCCATATGCTAGTAGCCATAAGTGTTACTTGTAAAGTTATCACCATG
TTCTTCAATGGATTTGCAATCTTTTTGTATAAACCACCTCCATCAGCCACAGATGTGTCA
TTTCATAAAGAGAATGCAGTTGTGACTAATGTTTTAGCAGAACAGGATCTCAACAAAATA
GTAAAAGAAGGGTGA
Chromosome Location
5
Locus
5q21.2
External Identifiers
ResourceLink
UniProtKB IDQ6ZQN7
UniProtKB Entry NameSO4C1_HUMAN
GenBank Protein ID33308060
GenBank Gene IDAF401643
HGNC IDHGNC:23612
General References
  1. Mikkaichi T, Suzuki T, Onogawa T, Tanemoto M, Mizutamari H, Okada M, Chaki T, Masuda S, Tokui T, Eto N, Abe M, Satoh F, Unno M, Hishinuma T, Inui K, Ito S, Goto J, Abe T: Isolation and characterization of a digoxin transporter and its rat homologue expressed in the kidney. Proc Natl Acad Sci U S A. 2004 Mar 9;101(10):3569-74. Epub 2004 Mar 1. [PubMed:14993604]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Chu XY, Bleasby K, Yabut J, Cai X, Chan GH, Hafey MJ, Xu S, Bergman AJ, Braun MP, Dean DC, Evers R: Transport of the dipeptidyl peptidase-4 inhibitor sitagliptin by human organic anion transporter 3, organic anion transporting polypeptide 4C1, and multidrug resistance P-glycoprotein. J Pharmacol Exp Ther. 2007 May;321(2):673-83. doi: 10.1124/jpet.106.116517. Epub 2007 Feb 21. [PubMed:17314201]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00390DigoxinapprovedunknownsubstrateDetails
DB01396Digitoxinapproved, investigationalunknowninhibitorDetails
DB00279Liothyronineapproved, vet_approvedunknownsubstrateDetails
DB01092OuabainapprovedunknownsubstrateDetails
DB01583LiotrixapprovedunknownsubstrateDetails
DB00451LevothyroxineapprovedunknownDetails
DB00509Dextrothyroxineapproved, investigationalunknownDetails
DB00563MethotrexateapprovedunknownDetails
DB06335SaxagliptinapprovedunknownsubstrateDetails
DB01137Levofloxacinapproved, investigationalunknowninhibitorDetails